KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_0789Help
Entry
YPTS_0789         CDS       T00744                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Brite
Enzymes [BR:ypb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YPTS_0789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ACC87773
LinkDB All DBs
Structure
PDB: 

Position
893688..894257
Genome map
AA seq 189 aa AA seqDB search
MKLSTLLLPVILYSSATLAANMAGMNDKASMNDKASMTVKINESLPQGNGKALGTVTVTE
TAYGLLFTPHLTGLAPGIHGFHLHEKPSCAPGMKDGKAVPALAAGGHLDPNKTGVHLGPY
NDKGHLGDLPGLVVNADGTATYPVLAPRLKSLSEVKQHALMIHAGGDNYSDHPMPLGGGG
ARMACGVIE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagtacattattgctacctgttattctttactccagcgcaacactggccgct
aacatggctggcatgaatgataaggccagcatgaatgataaggctagcatgactgtgaaa
atcaacgaatcattgccacaaggtaatgggaaagcgcttggcaccgtgacggtgactgaa
accgcttatggcttactgtttacgccacatctcactgggctggctccgggaattcacggt
ttccatctgcatgaaaaacccagttgtgctccggggatgaaagatggcaaggcagtgcca
gcattggcagccggggggcatcttgacccaaataagaccggggtacaccttggtccttac
aacgataaagggcatctgggggatctgccgggattggtggttaatgcagatggcaccgcc
acctatcccgtattggctccgcgcctgaaatcgttgtcagaggtgaaacagcatgcgtta
atgatccatgctggcggtgataattactctgatcatccaatgcctttaggcggtggtggc
gcacggatggcatgtggagtcattgagtaa

DBGET integrated database retrieval system