KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_1448Help
Entry
YPTS_1448         CDS       T00744                                 

Definition
(GenBank) peptidase S11 D-alanyl-D-alanine carboxypeptidase 1
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Pathway
ypb00550  Peptidoglycan biosynthesis
ypb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YPTS_1448
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ypb01002]
    YPTS_1448
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ypb01011]
    YPTS_1448
Enzymes [BR:ypb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     YPTS_1448
Peptidases [BR:ypb01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   YPTS_1448
Peptidoglycan biosynthesis and degradation proteins [BR:ypb01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   YPTS_1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ACC88420
LinkDB All DBs
Position
1608772..1609977
Genome map
AA seq 401 aa AA seqDB search
MMKYILPFKIKNFTFSAGLLLLALPAAYAVDDPAAPQIDAKAYVLMDFNSGKVLAEGNPD
LRLDPASLTKIMSSYVIGQSIKAGKIQPDDLVTVGKDAWATGNPALRGSSLMFLKPGDQV
KVSDLNKGIVIQSGNDASIALADYVAGSQDSFVGLMNNYAKALGLSNTHFMTVHGLDSPG
QYSTARDMALLGQALIRDVPEEYALHKEKEFTFNKIRQTNRNRLLWNSSLNVDGMKTGYT
NGAGYNLVASATDGPMRLISVVLGAPSDKVRFSESEKLLTWGFRFYETVVPIKSTKPFVT
EKVWLGDNSQVELGVAEDAAITIPKGQMKNLKASYTLNQTELRAPLAKHQVVGTIDFQLN
GKTIEQRPLVVLNEVKEGGIFSRFWDYVMMKLNQWFGGIFG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatatatcctccctttcaagattaaaaattttacgttcagtgcaggtttattg
cttctggcactgcctgctgcttatgcagtcgatgaccctgccgctccccagattgatgct
aaagcttatgtgctgatggattttaatagcggaaaagtgctggcagaaggcaatcctgat
ctgcgccttgatccggccagtttgacaaaaatcatgtccagctatgtgatcgggcagtcg
attaaagcgggcaaaatacagcctgatgatctggtcaccgtggggaaagacgcctgggcg
accggtaacccagctctgcgcggctcgtcgctgatgtttttgaagccgggcgatcaggta
aaagtgtctgatctcaacaaaggcattgtgatccaatcaggtaatgatgccagtattgca
ttggctgattatgtcgcgggtagtcaggacagttttgttggcctgatgaataactacgct
aaagcacttggcctgagtaatactcactttatgacggtacacggcctggattcaccgggg
cagtacagtactgcgcgtgatatggctttactggggcaggcattgatccgcgatgtgcca
gaagaatatgcgctgcataaagagaaagaatttacctttaataaaattcgccaaaccaac
cgtaaccggctgttatggaacagtagtttaaacgttgatgggatgaaaaccggttatacc
aacggggcggggtataatttggtcgcatcggcgacagatgggccgatgcgtttgatttcc
gtggtgctgggtgcaccaagtgacaaagtacgctttagtgaaagtgaaaaattgctgact
tggggtttccgcttctatgaaaccgtggtgccaattaaatcaacaaagccatttgtgaca
gagaaagtgtggcttggcgataacagccaggttgaacttggggtggcggaggatgcggcg
atcaccattcctaaagggcagatgaaaaatctgaaagccagttataccctgaaccaaacc
gagctacgcgcgccgctagcgaaacatcaagtggttggaaccatcgattttcaactcaat
ggcaaaaccattgaacagcgcccactcgtggtgttgaatgaggtcaaagaggggggcatc
tttagccgtttctgggattacgtaatgatgaaacttaaccaatggtttggtgggatattc
ggctaa

DBGET integrated database retrieval system