KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_1581Help
Entry
YPTS_1581         CDS       T00744                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Pathway
ypb00061  Fatty acid biosynthesis
ypb00780  Biotin metabolism
ypb01100  Metabolic pathways
ypb01130  Biosynthesis of antibiotics
ypb01212  Fatty acid metabolism
Module
ypb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YPTS_1581
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YPTS_1581
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    YPTS_1581
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ypb01004]
    YPTS_1581
Enzymes [BR:ypb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     YPTS_1581
Lipid biosynthesis proteins [BR:ypb01004]
 Fatty acid synthase
  Component type
   YPTS_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ACC88550
LinkDB All DBs
Position
1769043..1769780
Genome map
AA seq 245 aa AA seqDB search
MNLFISGGASGIGRSVVIAALSKGWNVGFSYHNNKEGAQQLLDIAVAEFPRQLCRAYQLD
VIDSGAVEYVGDRLLVDFSNIDAVVCNAGIDLPGNLVSMTDEDWALVLNTNLTGTFYLIR
YFLPLFLANKYGRIVTLSSLAKDGSSGQAAYAASKAGLVGLTKTTAKEYGHFGITANVVV
PGLINTEIIGDDIKGIKNFFAQYAPVGRLGSPSEVAEVILFLVAKESSYVNGAVFNVTGG
IDWVY
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaacctttttattagcggtggtgccagtggcattggacgaagtgtggtcattgctgct
ttgagcaaaggctggaatgttggctttagttatcacaataacaaggaaggtgcacaacag
ttgcttgatatcgcggtagcggagtttcctcggcaattatgtcgtgcctatcaactcgac
gttattgatagtggtgcagtagagtacgtgggagaccgtcttctcgtcgattttagtaac
attgatgcggttgtttgcaatgctggcatagatttaccgggcaatttggtgtcgatgacc
gatgaagattgggccttggtacttaatactaatttaactggcaccttctatcttattcgt
tattttttgcctctatttcttgctaataaatatgggcgcattgtcactctatcttcactc
gctaaagatgggtcatcaggacaagcggcttatgctgcatcaaaagctggtttggtgggg
ttaactaaaacaacagcgaaggaatatggacatttcggtattacggccaatgtcgttgtc
ccaggcttaattaataccgaaattattggtgatgacattaagggtattaagaattttttt
gctcaatatgcgccagtgggaaggctgggctcccccagtgaagtcgctgaggtcatttta
tttcttgttgctaaagaaagtagttatgtaaacggtgcggttttcaatgtgaccggtggc
attgactgggtttattaa

DBGET integrated database retrieval system