KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_2145Help
Entry
YPTS_2145         CDS       T00744                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
ypb00010  Glycolysis / Gluconeogenesis
ypb01100  Metabolic pathways
ypb01110  Biosynthesis of secondary metabolites
ypb01120  Microbial metabolism in diverse environments
ypb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPTS_2145
Enzymes [BR:ypb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     YPTS_2145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACC89108
LinkDB All DBs
Position
complement(2371018..2371893)
Genome map
AA seq 291 aa AA seqDB search
MNEKVFTLPVVEQISPYISQRQLDELPVVVVSHPKVRAAISLQGAHLLAYQPSGEQPIIW
LSNNTPFKEGIAIRGGVPICWPWFGPTAQPAHGFARILPWTLSAHDENENGVILTFTLED
NDMTRQYWPHAFTLIARFKLGDECEVELESHGDYQAAAALHTYFQIGDISQIKVSGLGEK
YLDKVLKVADVTQQGDLVFNGQTDRVYTQPEAYSLIKDAALKRTIEVHHHHQSDVVAWNP
GAELSCSMVDMPNDGYKTMVCVETARVNKPLVAAPDAPARLAMTIRSRKNT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaagtatttactctccctgttgttgaacaaatttctccttatatcagccag
cgtcaactggatgaattgccggtagtggttgtttctcatcctaaggtgcgtgcggcaata
agtttgcagggggcccacttactggcctatcaacccagtggtgagcaacccattatctgg
ctgagcaataacacgccttttaaagaaggtattgcgattcgtggaggggttccaatttgt
tggccttggtttggcccaaccgcacaacctgcccatggttttgcccgcatcttgccatgg
acgctcagtgctcatgatgaaaatgaaaacggcgtcattctgactttcacccttgaagac
aacgacatgacccgccaatactggccacatgccttcaccctgatcgcccgtttcaagttg
ggagatgaatgtgaagttgaactggaatcacacggtgattatcaggctgctgcggcatta
catacctacttccagattggcgatataagccaaattaaagtcagcgggctgggtgagaaa
tatttagataaagtgctgaaagttgccgatgtcactcaacaaggcgatttagtctttaac
ggccaaactgaccgtgtctatacccaacctgaagcctatagtctgataaaagatgccgcg
ctgaaacgaactattgaggtccatcaccatcaccaaagtgatgtggttgcttggaacccc
ggcgctgaattgtcctgcagcatggtagatatgccaaatgatggctataaaacgatggtt
tgcgtagaaaccgcacgagtcaacaagccattggtggctgcgcctgatgcaccagcacgt
ttggcgatgaccatccgtagccgtaaaaacacctaa

DBGET integrated database retrieval system