KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_2358Help
Entry
YPTS_2358         CDS       T00744                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Pathway
ypb00480  Glutathione metabolism
ypb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YPTS_2358
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypb02000]
    YPTS_2358
Enzymes [BR:ypb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     YPTS_2358
Transporters [BR:ypb02000]
 Other transporters
  Pores ion channels [TC:1]
   YPTS_2358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: ACC89319
LinkDB All DBs
Position
2612996..2613601
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLSPHIVLREAGLDFSIERVDLVTKKTETGADYLSINPKGQVPALVLDDG
SLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFIATELHKGFSPLFNPNTPDE
YKTIVRERLDKQFSYVDSVLAEHDYLLGKKFSVADAYLFTVSRWANALNLQIKERSHLDQ
YMARVAERPAVKAALAAEDIK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaaccgggtgcttgttctctgtccccccatattgtgttgcgggaa
gcaggactagatttcagcattgaacgtgttgatttagtgacaaaaaagactgaaacgggt
gcagactatttaagcatcaaccccaaaggacaagtaccggccttagtgctggatgacggt
agcctactgactgaaggggtagctattgtgcaatatttggcagataaagtcccagaccgc
cacttgattgccccatcagggacgctctcgcgctatcatgccattgagtggctgaatttt
atcgcgactgaactacataaaggttttagcccactatttaatccaaatacaccagatgag
tataagacgattgtccgcgagcggctggataagcaattcagctacgttgatagcgtatta
gcagagcatgattatctactaggtaaaaaattcagtgtggcagatgcctacttatttacc
gttagccgttgggctaatgcgttaaatcttcaaatcaaagaacgcagccatttggatcaa
tatatggcgcgggtcgctgaacgccctgcggtaaaagcagctttagccgccgaagatatc
aagtaa

DBGET integrated database retrieval system