KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_2510Help
Entry
YPTS_2510         CDS       T00744                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
ypb00020  Citrate cycle (TCA cycle)
ypb00480  Glutathione metabolism
ypb01100  Metabolic pathways
ypb01110  Biosynthesis of secondary metabolites
ypb01120  Microbial metabolism in diverse environments
ypb01130  Biosynthesis of antibiotics
ypb01200  Carbon metabolism
ypb01210  2-Oxocarboxylic acid metabolism
ypb01230  Biosynthesis of amino acids
Module
ypb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPTS_2510
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YPTS_2510
Enzymes [BR:ypb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     YPTS_2510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: ACC89471
LinkDB All DBs
Position
complement(2787176..2788429)
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMINVVDAAVKKAYNG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYEGTPSPVKHPELTNMVIFRENAEDIYAGIEWKAGSPEAEKVIKFL
REEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKEIIVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDDCALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIIKGTEGAIQAKTVTYDFERLMEGAKLLKCSEFGDAIIKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaagaaaattactgtcgatgctcagggt
aaactggttgttccgcataatccgatcattccatttattgaaggtgacggtattggtgtt
gatgtaaccccggcgatgatcaacgtggtagatgctgcggttaagaaagcttataacggt
gaacgtaaaatttcctggatggaaatttacactggtgagaaatcaacccatgtctatggt
aaagatgtttggttgccagaagaaaccttagatctgatccgtgattatcgcgttgctatc
aaaggcccgttgaccactcctgtcggtggcggcatccgttctttgaacgttgctctgcgt
caacaacttgacctgtatgtgtgtctgcgtccggtgcgttattatgaaggcaccccaagc
ccggtaaaacaccctgaactgaccaacatggtgattttccgtgaaaacgctgaagatatc
tatgcgggtatcgaatggaaagcgggttcacccgaagcagagaaagtgatcaagttcctg
cgtgaagagatgggtgtgaagaaaatccgtttccctgaacaatgtggtatcggtgtgaaa
ccgtgttcagaagaagggactaagcgtttggtacgtgcagcgattgaatatgcaattacc
aacgatcgtgaatcagttacgctggttcataaaggcaacattatgaaattcaccgaaggc
gcgtttaaagactggggttatcagttagcgcgtgaggaatttggtggtgaactgatcgac
ggtggcccatgggttaaaatcaaaaacccaaataacggcaaagaaattatcgttaaagat
gtgattgccgatgctttcctgcaacagatcctgctgcgtcctgcggaatatgatgttatc
gcttgtatgaacctgaacggtgattacatctctgatgcattggcagctcaggttggcggt
attggtattgctccgggggctaacattggtgatgactgcgcactgttcgaagccactcac
ggtactgcaccaaaatatgctggtcaggataaagtgaacccaggttctattattctttca
gcagaaatgatgctgcgtcacatgggctggttcgaagccgctgacttaatcattaaaggc
actgaaggcgcaattcaagccaagaccgtgacttatgatttcgaacgtctgatggaaggc
gctaagttgttgaagtgtagtgagtttggcgacgccattattaagcacatgtaa

DBGET integrated database retrieval system