KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_2733Help
Entry
YPTS_2733         CDS       T00744                                 

Definition
(GenBank) fatty acid oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Pathway
ypb00071  Fatty acid degradation
ypb00280  Valine, leucine and isoleucine degradation
ypb00281  Geraniol degradation
ypb00310  Lysine degradation
ypb00362  Benzoate degradation
ypb00380  Tryptophan metabolism
ypb00410  beta-Alanine metabolism
ypb00640  Propanoate metabolism
ypb00650  Butanoate metabolism
ypb00903  Limonene and pinene degradation
ypb00930  Caprolactam degradation
ypb01100  Metabolic pathways
ypb01110  Biosynthesis of secondary metabolites
ypb01120  Microbial metabolism in diverse environments
ypb01130  Biosynthesis of antibiotics
ypb01200  Carbon metabolism
ypb01212  Fatty acid metabolism
Module
ypb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    YPTS_2733
   00650 Butanoate metabolism
    YPTS_2733
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YPTS_2733
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YPTS_2733
   00310 Lysine degradation
    YPTS_2733
   00380 Tryptophan metabolism
    YPTS_2733
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YPTS_2733
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YPTS_2733
   00281 Geraniol degradation
    YPTS_2733
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YPTS_2733
   00930 Caprolactam degradation
    YPTS_2733
Enzymes [BR:ypb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YPTS_2733
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YPTS_2733
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YPTS_2733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ACC89693
LinkDB All DBs
Position
complement(3031736..3034078)
Genome map
AA seq 780 aa AA seqDB search
MSKENIVTRENTAVSENAVSEPTVNNDVGASATNSVTHPAFTLNVRPDNIGIITIDVVGD
KVNTLKAEFADQIATILQQAHALPKLQGLVIVSGKPDSFIAGADITMIAACRTAHDARVL
AQKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRICSLDDKTVLGLPEVQLGLL
PGSGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRAKAGW
LNRRALPWQERLLSGPLGKALLFRIVRKKTLAKTRGHYPAAERIIDVVRKGLDQGGPSGY
EAEARAFGELAMSPQSAALRSLFFATTSLKKETGSAATARAIHRVGVLGGGLMGGGIANV
TATRAGLPVRIKDINPQGINQALKYTWDALGKRVRSKRMRPTEQQRQMMLISGSTDYRGF
ERVDIVVEAVFEDLSLKQQMVADIERFGAAHTIFASNTSSLPISQIAALAQRPEQVIGLH
YFSPVDKMPLVEVIPHEKTSEETIATTVALARKQGKTAIVVADRAGFYVNRILAPYINEA
ARCLLDGEPIESVDNALVDFGFPVGPMMLLDEVGIDVATKIMPILVEQLGPRFAAPPSFD
VILKDGRKGRKNGRGFYLYSNPTLHSNSTKNSSPTKNGNSPAKRNSFKWRKNKVKPVDSS
IYTLLGVTPKAHLGAGVITQRCTMLMLNEAVRCLDESIIRNPRDGDIGAVFGIGFPPFLG
GPFRYLDSLGADKVVQALRLLVQQYGERFEPCQRLVTMAEQQQQFYPVDANIDEVTDVAS
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggaaaatatcgttacccgtgaaaatacagctgtcagtgaaaatgcagtcagt
gaacctacagtgaataatgatgtgggcgcatcggccacgaattcagttacccatcccgca
tttaccctcaacgtaaggccggacaatattggcattatcaccattgatgttgttggtgac
aaagtgaataccctaaaggctgaatttgctgatcaaattgccactatattgcaacaagcg
cacgctctaccaaaattacagggactcgtcattgtttctggcaaaccagactccttcatt
gccggtgcggatatcacgatgatcgcggcttgtcgtaccgctcacgacgcccgcgtatta
gcacaaaaaggccaatcaattttggcgcaaattgccgctttccctgtgccggttgtggct
gcgattcatggcgcttgtctggggggagggctagagctggcgctggcttgccatagccgc
atatgttctctggatgataaaaccgttctcgggctaccggaggtgcaactggggttactg
cctggctccggcgggacgcaacgtctgccgcgtttagtgggggtcagtaaagcactggat
atgatattgaccggtaaacagatacggccccgtcaggcactaaaaatggggctggtggat
gatgttgtgccacgcgatatcttattggatgtggcgattcagcgcgcgaaagcggggtgg
cttaatcgacgagcattaccatggcaggagcgtttactcagtgggccgttgggtaaagct
ttattattccgtattgtccgtaaaaaaacgttagctaaaacgcgggggcactacccggcg
gctgaacgtattattgatgtggtgcgtaaaggattagatcagggcgggccaagtggttat
gaggcagaagccagagcatttggcgagttggcgatgtcgcctcagtcagccgcattacgc
agcctatttttcgccacgacgtcactgaaaaaagagaccggaagtgcagccacagcgcgt
gcaattcatcgggtcggcgtattgggcggtggcttgatgggcggaggtattgccaacgta
acggctacccgagcgggcttgccagtgcgtatcaaagatatcaatccgcaaggaattaat
caggcgctgaaatatacctgggacgcattgggtaaacgggttcgtagtaagcggatgcgc
ccaactgaacagcagcggcagatgatgttgatctctggtagtacggattaccgtggtttt
gaacgtgtcgatattgtggtggaagcggtatttgaggatttatcactgaagcagcaaatg
gttgctgacatcgaacgatttggtgccgcccatactatttttgcctccaatacatcatca
ctccccatcagccagattgctgctttggcacaacggccagagcaggttattggcctgcac
tattttagtccagtagataaaatgccactggttgaagtcatcccccatgaaaaaaccagt
gaagagaccatcgctaccaccgttgctttagcccggaaacagggtaaaacagccattgtg
gtggctgatcgcgctgggttctatgtaaaccgcattttggcaccttatattaatgaagct
gcccgttgcctgctcgacggagagcctatcgaatcagttgataacgcgttggtcgatttt
ggtttccccgtaggccccatgatgctgcttgatgaggttgggattgatgttgcgaccaaa
ataatgccgattctggtcgagcaattagggccgcgttttgctgcgcccccgtcatttgac
gttattttgaaggatggacgtaaagggcgcaaaaatggccgtggcttttatttatattca
aaccccacactgcattcaaattccacaaaaaattcatctccaacaaaaaatgggaattct
ccggcgaagcgtaatagctttaagtggagaaaaaacaaagtaaaaccagtcgattccagt
atctataccttgttgggggtgacacctaaagcccatcttggtgcaggcgtgattactcaa
cgttgtaccatgctgatgttgaacgaagcggtacgctgtctggatgaatcgatcattcgt
aacccgcgcgatggtgatattggtgcagtgtttgggatcggttttccgcctttcctcggt
ggtccgttccgctatttggatagcctgggagccgataaggtggtacaagcactcagatta
ttggtacagcaatacggtgagcgtttcgaaccttgccagcggttggtaacaatggctgaa
caacaacaacaattctatcccgtggacgccaatatagatgaggtgacggatgtggcaagc
tga

DBGET integrated database retrieval system