KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_3894Help
Entry
YPTS_3894         CDS       T00744                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ypb03012]
    YPTS_3894
   03029 Mitochondrial biogenesis [BR:ypb03029]
    YPTS_3894
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypb04147]
    YPTS_3894
Translation factors [BR:ypb03012]
 Eukaryotic Type
  Elongation factors
   YPTS_3894
 Prokaryotic Type
   YPTS_3894
Mitochondrial biogenesis [BR:ypb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    YPTS_3894
Exosome [BR:ypb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YPTS_3894
  Exosomal proteins of breast cancer cells
   YPTS_3894
  Exosomal proteins of colorectal cancer cells
   YPTS_3894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ACC90843
LinkDB All DBs
Position
complement(4329900..4331084)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSAYDFPGDDLPVVRGSALKALE
GEAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREDIERGQVLAKPGSIK
PHTTFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNINMI
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtaccaaaccccatgtaaacgtcggtactatcggccac
gttgaccatggtaaaactaccctgacagcagcaatcaccaccgttctggctaaaacctac
ggcggtagcgctcgtgctttcgatcaaatcgataacgcaccagaagaaaaagcacgtggt
atcaccatcaacacttctcacgttgaatatgatactcctgctcgtcactatgcgcacgtt
gactgcccaggtcacgccgactatgttaaaaacatgatcaccggtgctgctcagatggat
ggtgcaatcctggttgttgctgcaactgatggccctatgccacagactcgtgagcacatc
ctgttgggtcgtcaggttggcgttccttacatcatcgtattcatgaacaaatgtgacatg
gttgatgatgaagagctgctggaactggtagaaatggaagttcgtgaacttctgtctgct
tacgacttccctggcgatgatctgccagttgttcgtggttcagcgctgaaagcactggaa
ggcgaagctgagtgggaagctaaaatcatcgaactggctggttacctggattcttatatc
ccagaaccagaacgtgctatcgacaagccgttcctgctgccaatcgaagacgtattctct
atctcaggccgtggtactgtagtaactggtcgtgtagagcgcggtatcgttaaagtcggc
gaagaagttgaaatcgtcggtatcaaagatactgttaaatctacttgtactggcgttgaa
atgttccgcaaattgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagatatcgaacgtggtcaagttctggctaaaccaggttctatcaaa
ccacacactacctttgaatcagaagtttatattctgagcaaagatgaaggcggccgtcat
actccgttcttcaaaggctaccgtcctcagttctacttccgtacaactgacgtaaccggt
accatcgaattgccagaaggcgttgaaatggtgatgccaggtgacaacatcaacatgatt
gttaccctgattcacccaatcgcaatggacgacggcttgcgtttcgcaatccgtgaaggc
ggccgtactgtaggcgctggtgttgttgctaaagtaatcgcttaa

DBGET integrated database retrieval system