KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_3979Help
Entry
YPTS_3979         CDS       T00744                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
ypb00564  Glycerophospholipid metabolism
ypb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    YPTS_3979
Enzymes [BR:ypb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     YPTS_3979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: ACC90928
LinkDB All DBs
Position
4421490..4423004
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVKHGGEVRTRTKVTRAWREQG
LWMVEALDVNTGKTFTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDDYSIIGTTDVEYHGDPKEVKIDDQEMTYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEAGQAPLLSVFGGKLTTYRK
LAEHALEKLSAYYPNVGPAWTKTGALPGGDIGGSRDSYTVQLRHRYNWLPEGLARRYTRT
YGSHSELILANATRLESLGEHFGHGLYEAELRYLVENEWVVELDDAIWRRTKLGMALSDE
EKQRVAQWLADAHTEKQQALPLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgtgatcggtggcggtattaacggtgccggtatcgctgcg
gacgctgctgggcgtggcctgtcggtactgctgctggaagcgcaagacttggcctgtgct
acgtcttccgccagttccaaacttatccatggtggcttacgctatctggaacattatgaa
ttccgcttggtaagtgaagccttggccgagcgtgaagtgttactgaaactggcaccgcat
atcgcattccctatgcgcttccgcctaccccaccagcctcatctgcgcccggcatggatg
atccgcaccggcttgttcttgtatgaccatttgggcaaacgtaccagcctgccagccagt
aaagggctgcgttttgggccggaatctgtgttaaaacccgagttggtgcgcggtttcgaa
tattctgactgttgggtggatgatgcccgcctggtggtgctgaatgcgcaggaagtggtt
aaacacggcggtgaagtccgaacccgtaccaaagtgacccgtgcctggcgtgaacaaggc
ctatggatggttgaagcccttgatgtcaatactggcaaaaccttcacctggcgggctaaa
ggcttagtgaatgccactggcccttgggttaaacagttcttcgacgatggcctaaagctc
aaatcaccttatggcatccgcctaattaaaggcagccacattgtggtgccccgggttcat
aaccaaccgcaggcgtatattctgcaaaatgaagatcaccgtatcgttttcgttatccct
tggttagatgactattccatcatcggtactaccgacgtggaataccacggcgatccaaaa
gaggtgaaaattgacgatcaggaaatgacttatctgctgaaagtctataacgaccacttt
aaaaaacagttgggtcgtgacgatatcgtctggacctactctggtgtgcgcccgctatgc
gacgatgaatcagattcaccgcaagccgttacccgcgattacacgctagatgtggccgat
gaagcgggtcaggcaccactcctgtcggtcttcggcggtaaactcaccacctaccgtaaa
ttggcagaacatgcgctggaaaaactgtcagcgtactacccgaatgtcggcccagcgtgg
actaaaaccggtgccttgcccggtggggatatcggcggtagtcgtgatagctataccgtg
caattgcgccaccgctataactggttgccggaaggattggcccgccgctatacccgtacc
tatggtagccacagcgagctaattttagccaatgcgacccgtcttgaaagcctgggtgag
cactttggtcacggcttgtatgaggctgaattgcgctatttggttgagaacgagtgggtc
gttgagctggatgatgctatctggcgccgtaccaaattaggcatggccctcagcgatgaa
gagaaacagcgggtagcccagtggctggctgatgcgcacactgaaaaacaacaggcgctg
ccgctggtttcttaa

DBGET integrated database retrieval system