KEGG   Yersinia pseudotuberculosis 1: BZ23_1667Help
Entry
BZ23_1667         CDS       T03679                                 

Definition
(GenBank) thymidine kinase family protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ypc  Yersinia pseudotuberculosis 1
Pathway
ypc00240  Pyrimidine metabolism
ypc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BZ23_1667
Enzymes [BR:ypc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BZ23_1667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AJJ69569
UniProt: A0A2A7VF96
LinkDB All DBs
Position
1851434..1852024
Genome map
AA seq 196 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRFGVGTVSSRIGLSSQAQ
LYNSGTSLLSIIAAEHQDTPIHCILLDECQFLTKEQVQELCQVVDELHLPVLCYGLRTDF
LGELFPGSKYLLAWADKLVELKTICHCGRKANMVLRLDEQGRAVHNGEQVVIGGNESYVS
VCRRHYKEAIKAACCS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttacttttattactctgcaatgaacgcggggaaatccacagcacttcta
cagtcctcatataactaccaagaacgaggtatgcgcaccttggtgtttacggctgagata
gataaccgctttggtgtcggaacggtaagttcacgcattggcctctcttctcaggcccag
ctctataatagcgggacatcattgttatctattatcgccgctgagcaccaggacacacct
attcattgtattctattggatgaatgtcaatttctgactaaagagcaggtccaggaactc
tgtcaggttgttgatgaattacatcttcctgttctttgctacggcctgcggactgatttt
ctcggcgaattatttcccggtagtaaatatttactggcgtgggcggacaaattagtggag
ttgaaaaccatttgtcattgcggtcgtaaagcaaacatggttcttcgcctggatgagcag
gggagagcggtacacaatggtgaacaggtcgttattggtggcaatgaaagctatgtttct
gtctgccgccgccattataaagaagcaattaaagccgcctgctgttcgtag

DBGET integrated database retrieval system