KEGG   Yersinia pseudotuberculosis 1: BZ23_167Help
Entry
BZ23_167          CDS       T03679                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ypc  Yersinia pseudotuberculosis 1
Pathway
ypc00473  D-Alanine metabolism
ypc00550  Peptidoglycan biosynthesis
ypc01100  Metabolic pathways
ypc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ypc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BZ23_167
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BZ23_167
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BZ23_167
Enzymes [BR:ypc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BZ23_167
Peptidoglycan biosynthesis and degradation proteins [BR:ypc01011]
 Precursor biosynthesis
  Amino acid ligase
   BZ23_167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_Ter ATP-grasp ATP-grasp_3 ATPgrasp_YheCD ATPgrasp_ST TTL RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AJJ71109
UniProt: A0A2A7VNF9
LinkDB All DBs
Position
209438..210358
Genome map
AA seq 306 aa AA seqDB search
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFI
ALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQ
QFETLSPEELVACVAKLGLPLIVKPSHEGSSVGMSKVDHASELQKALVEAFQHDSDVLIE
KWLSGPEFTVAILGDEVLPSIRIQPPGVFYDYDAKYLSDKTQYFCPSGLSDESEQQLAAL
ALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVAR
ILMLAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaagtcgcggtattgctgggtgggacctctgcggagcgtgaagtgtcatta
ctgtcaggtcaggcggtattggcaggcttgaaagaagccggtatcgatgcttatggggtg
gataccaaagattttccggtaactcagcttaaagaacagggctttgataaagtgtttatc
gccctgcatggtcgtggtggcgaagacggtacgttacaaggcgtattggaatttctacaa
ctgccatataccggcagtggtgtaatggcatccgccctgacaatggacaaattgcgcacc
aaattagtctggcaagccttggggttgcctatttcgccttatgttgcgttgaatcgccaa
cagtttgaaacactttccccagaggaattggtggcgtgtgtcgctaagcttggcctgcca
cttattgtcaagccaagccatgaaggctctagcgttgggatgagtaaagttgatcacgcc
agcgaattgcagaaggcattggttgaagctttccaacatgacagcgatgtactgattgag
aaatggctgagcgggccagagtttactgtcgcgatccttggggatgaagttttgccttct
attcgtattcagcctccgggcgtgttttacgattatgacgctaagtatttgtcagataaa
acacaatacttctgcccaagcggtttaagtgatgagtcggagcaacaattggcagcgctg
gcattgcaggcttaccacgcgctggattgcagcggttgggggcgggtcgatgtgatgcaa
gaccgcgatggtcatttttacctgcttgaagtgaacacttcaccgggtatgaccagccat
agtttggttccaatggccgcccgccagtatgggttgagtttctcccaattggtggcgcgc
attctgatgttggctgactga

DBGET integrated database retrieval system