KEGG   Yersinia pseudotuberculosis 1: BZ23_273Help
Entry
BZ23_273          CDS       T03679                                 

Definition
(GenBank) xylose isomerase-like TIM barrel family protein
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
ypc  Yersinia pseudotuberculosis 1
Pathway
ypc00040  Pentose and glucuronate interconversions
ypc00053  Ascorbate and aldarate metabolism
ypc01100  Metabolic pathways
ypc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ypc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BZ23_273
   00053 Ascorbate and aldarate metabolism
    BZ23_273
Enzymes [BR:ypc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     BZ23_273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AJJ70611
LinkDB All DBs
Position
complement(337939..338820)
Genome map
AA seq 293 aa AA seqDB search
MRIHPLGIYEKALPAGTSWVEKLAVAKSCGFDFVEMSVDESDERLARLDWSREERMAVIS
AIQQTGVRIPTLCLSAHRRYPFGSRDATTREQAHTVMLQAIRLAQDLGIRTIQLAGYDVY
YEPQDSETIARFEAGIAWAVKQAAAAQVMCAVEIMDTQFMNSISKWKALDNKIGSPWFTV
YPDIGNLTAWGNEVNSELAKGIDRIAAIHLKDTFAVTADSPGQFRDVPFGEGCVDFVNLF
KTLRRLNYRGTFLIEMWTEKAAEPLLEIIHARHWIEDKMRLAGWDNESGQLTR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattcacccactaggaatatacgaaaaagccctacctgcgggcaccagttgggtc
gaaaagctggcggtagcaaaatcctgcggcttcgactttgttgaaatgtccgttgatgag
agtgatgagcggctggctcgtctggattggagccgcgaggagcgtatggcggtgatcagt
gccattcaacagaccggggtgcgcattccaaccctgtgcctctcggctcaccgccgctat
ccattcggtagccgcgatgccaccacgcgggagcaagcgcatacggtcatgttacaggct
atccgtctggcgcaggatcttgggatccgtaccattcaactggcaggatacgatgtgtac
tacgaaccgcaggatagtgaaacgatcgcacgttttgaagcgggtatcgcctgggcggtg
aagcaagccgcggcagcgcaagtgatgtgtgcggtcgagatcatggacacccagtttatg
aactccatcagtaagtggaaggcgctggacaacaagattggctctccgtggtttaccgtc
taccccgatatcggcaacctcacggcctggggcaatgaagtcaacagtgaattggcaaaa
gggattgaccgcattgcagcgatccatctgaaagatacctttgccgtcaccgctgactcc
cccggccaatttcgtgatgtgccgtttggtgaaggctgtgtcgatttcgttaatctgttt
aaaaccctgcgccgcctgaactatcgcggaaccttcctgatagagatgtggacagaaaaa
gcggctgagcctttgctggaaattatccatgcccgccactggatcgaagacaaaatgcgg
ttggctggctgggataacgaatccggccagttaacccgctaa

DBGET integrated database retrieval system