KEGG   Yersinia pseudotuberculosis 1: BZ23_3365Help
Entry
BZ23_3365         CDS       T03679                                 

Gene name
gph
Definition
(GenBank) sugar (Glycoside-Pentoside-Hexuronide) transporter
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
ypc  Yersinia pseudotuberculosis 1
Pathway
ypc00630  Glyoxylate and dicarboxylate metabolism
ypc01100  Metabolic pathways
ypc01110  Biosynthesis of secondary metabolites
ypc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ypc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BZ23_3365 (gph)
Enzymes [BR:ypc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     BZ23_3365 (gph)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AJJ70126
UniProt: A0A3G5IW70
LinkDB All DBs
Position
complement(3822618..3823316)
Genome map
AA seq 232 aa AA seqDB search
MVKFKAIRGVAFDLDGTLVDSAPGLARAIDMALAHQGLPAAGEALVSTWIGNGADVLVER
ALHWAGREHNAQLVAQTRELFDHYYAKTVEQGSQLFPQVKATLAQLAANGLPIGLITNKP
TPFVAPLLTSLGIADYFSVIIGGDDVVVKKPHPAPLYLLLGKLGLHAREMLFVGDSRNDI
MAAQAAGCPCIGLTYGYNYGEAIATSHPDCVLAHFADLLPAIGLPSLKDQEV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggttaagtttaaggcgattcgtggtgttgcattcgatctggatggcacattagtcgac
agcgcgcccggtctggcccgtgcaattgatatggcgttggcgcatcaggggttacctgcc
gctggtgaagcgttagtctccacttggattggtaatggcgcagatgtcttagtcgagcgc
gcgttgcattgggcagggcgtgaacataatgctcagcttgtggcacagacccgcgagctg
tttgatcactattatgccaaaaccgttgagcaggggagccagttattcccgcaagtgaaa
gccactttagctcaattggctgccaatggtttgccaataggcctcattaccaataagcca
acaccgtttgttgcccctttactaacgtcattggggatcgcggactatttctcagtcatc
attgggggcgatgatgtggtggtgaagaaaccgcatccggccccgttgtatttattgctg
ggaaaacttggcttacatgcccgtgaaatgctgtttgtcggtgactcgcgtaatgacatt
atggccgcacaggcggcgggttgcccttgtattgggctgacctatggatataactacggt
gaagcgattgccaccagtcatccagactgcgtgctggcgcattttgccgacctgttgccc
gccattgggctaccatctttaaaagatcaggaagtataa

DBGET integrated database retrieval system