KEGG   Yersinia pseudotuberculosis 1: BZ23_3561Help
Entry
BZ23_3561         CDS       T03679                                 

Definition
(GenBank) alpha amylase, catalytic domain protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ypc  Yersinia pseudotuberculosis 1
Pathway
ypc00500  Starch and sucrose metabolism
ypc01100  Metabolic pathways
ypc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BZ23_3561
Enzymes [BR:ypc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BZ23_3561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AJJ70251
LinkDB All DBs
Position
4063975..4066038
Genome map
AA seq 687 aa AA seqDB search
MKRLTLPLLLVLSPAAMANWSLQHFPAFTEQDSGIFLSSSALTKGEYPLKFYQDKQCWQP
TGPVKLNQMLSLQPCQENIAIPWRLFRDGQYQARIDTRSGTPTLTLSVTAPVAEAIQVVT
HSCQRWDGNPVTVDVSKTFAEGEIVRDFYSGQTATVSLGKITLRPAPESGGLLLLESAQT
QQAAPFSWQNATVYFALTDRFNNGNPANDHSYGRHGDGMQEIGTFHGGDLAGLTEKLDYL
QQLGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYGLDWTRLDANMGTEQDLRTLVE
QAHKRGIRILFDVVMNHVGYATLADMQNDQFGALYLQGDQQEKTLGKHWSDWTPGSGQTW
HSFNDYINFSDKTAWDNWWGKKWIRTDIGDYDTPGYDDLTMSLAFLPDIKTESTQPSGLP
VFYRNKPDTAAQEIAGATPRDYMTHWLSQWVRDYGIDGFRVDTAKHVEKPAWQQLKQQSI
AALAEWKAAHPEQALDNLPFWMTGEAWGHGVMKSDYYQNGFDAMINFDFQDQANQALACF
SSIESTYNQMAEKLQNFNVLSYLSSHDTRLFFKDDAQQSLAKQQRAGSLLLLAPGAVQIF
YGDESGRKFGPTGSDPLQGTRSDMNWSELSGEKGALLAHWQKVSQFRARHPAIGAGVQQS
QQTANYYAFSRQHQGDKVLVVWVGDKN
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtctcacactccccttgctactggttctttcaccagcagcgatggcgaactgg
tccctacagcatttcccggcttttactgaacaggacagcggtatttttctcagtagcagc
gcactgaccaaaggcgaataccctctaaaattttatcaggataaacagtgctggcagcca
accgggccggtaaagctgaaccaaatgctctcgttgcagccttgccaggagaatatcgcg
ataccgtggcggttgttccgtgatggccagtatcaagcgcgaatcgatacccgtagcggc
accccgacgctgaccttaagtgtcaccgcacccgtagcggaggcaatccaggtcgtcacc
cacagttgccaacgctgggatggcaatcctgtgaccgtggatgtcagtaaaacctttgcc
gaaggtgaaattgtacgggatttctattccggccaaacagcaaccgtttccctcggcaaa
attacgctacgacccgccccagagagtggtggtttactgctgttggaatcggcccaaaca
cagcaagccgccccttttagctggcaaaacgctacggtctattttgccctgacggacaga
tttaataacggcaacccagcgaacgaccatagctatggccgtcatggcgatgggatgcag
gagataggaacgtttcacggtggcgatttggcggggcttaccgagaagctggattatctg
caacagcttggggtcaacgcactgtggatcagttctccactggaacaaattcacggctgg
gtcggcggggggaccaaaggcgacttcccacattatgcctatcatggctactacgggctg
gactggacccgtctggatgccaatatgggcaccgaacaggatttacgcacactggttgaa
caggcacataaacgcggcattcgcatcttatttgatgtggtgatgaatcatgtgggttat
gcaacgctggcggatatgcagaacgaccaattcggggcgctctacctgcaaggcgatcaa
caggaaaaaaccttgggtaagcattggagcgactggacccctggcagcgggcagacctgg
cacagctttaatgactacatcaacttcagtgataagaccgcttgggataattggtggggt
aaaaaatggatccgcaccgatattggtgattacgacacccccggttatgacgatctgacg
atgtcgctggccttcctacccgatatcaaaacagaatcgacgcagcccagcggtttgcca
gtgttttaccgtaacaaaccggacaccgcagcccaagaaatcgccggtgcgacaccccgt
gattatatgacgcattggttaagccaatgggtacgcgattacggcattgacggttttcgg
gttgatactgccaagcatgtagagaaacccgcctggcaacaattaaagcagcagagcatc
gcggcactggccgaatggaaagccgcacatccagaacaggcgctggataatctgccattt
tggatgaccggagaggcttggggccacggtgtcatgaaaagtgattactaccaaaatggc
tttgatgccatgattaattttgattttcaggatcaggcaaatcaggcgctggcctgcttc
tcatctatcgagagtacctacaaccaaatggcggagaaactgcaaaacttcaatgtgttg
agctacctctcgtctcacgatacccggttattctttaaagacgatgcacaacagtcactg
gcaaaacagcagcgagcaggctctttactgttgttggctccgggggcagtacaaatcttc
tacggtgatgaaagcgggcggaagtttggcccaaccggttccgatccgttgcagggtacc
cgttcggatatgaactggagtgagctatcgggcgaaaaaggcgcactgttggcccattgg
caaaaagtcagtcaattccgcgcccgtcatcccgcgataggcgctggtgtacaacaatcg
caacaaaccgccaattactatgcctttagccgccaacatcagggcgataaggttctggtc
gtttgggtcggtgataagaactga

DBGET integrated database retrieval system