KEGG   Yersinia pseudotuberculosis 1: BZ23_3726Help
Entry
BZ23_3726         CDS       T03679                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ypc  Yersinia pseudotuberculosis 1
Pathway
ypc00620  Pyruvate metabolism
ypc00680  Methane metabolism
ypc01100  Metabolic pathways
ypc01120  Microbial metabolism in diverse environments
ypc01200  Carbon metabolism
Module
ypc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ypc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BZ23_3726
  09102 Energy metabolism
   00680 Methane metabolism
    BZ23_3726
Enzymes [BR:ypc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BZ23_3726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJJ70439
UniProt: A0A2A7VKU9
LinkDB All DBs
Position
complement(4243284..4245920)
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGTLLGDTIKEALGEHILDRVETIRKLSKSSRAGNEASRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPEALAQLFTRLKDKKLSDQD
MRSAVDDLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWEGVPAFLREFNEQLENSLDYRLPVEAV
PIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLRDIQVLVSELSMSECTPELRE
LAGGEEVLEPYRQLMKNVRTQLTNTQAYLEARLKGERVLPPHDLLVSNDQLWEPLYACYQ
SLKACGMEIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTDAIAELTRYLGLGDYESW
SESDKQAFLVRELNSKRPLVPLKWEPSAETQEVLETCRVIAEAPQGSIAAYVISMAKVPS
DVLAVHLLLKEAGCPFTLPVAPLFETLDDLNNADDVMTQLLGIDWYRGLIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGITLTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYAGAILEANLLPPPEPKKEWIEVMDLLS
DASCDMYRSYVRENPEFVRYFRAATPELELGKLPLGSRPAKRRPDGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQRAIDAGKRDVLATMCRDWPFFSTRIGMLEMVFAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLAADIKVVLAIANDDHLMADLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQEHPDACVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaacgtcagtatgctcggcacactactcgga
gacaccatcaaggaagcgttgggagagcatattcttgatagagtagaaaccatccggaaa
ttatccaaatcttcgcgtgcgggtaatgaagcgagccgtcaggaattactgaccacactg
caaaatctttccaacgatgagctactgccggtcgcccgtgcctttagccaattccttaat
ctgacgaatacggcagagcaataccacagtatttcaccacatggtgaagccgcgagtaat
ccggaagccctcgcccaattatttacccgcttaaaagataaaaagctgagcgatcaagat
atgcgcagcgcggttgacgatttgtcgattgagttggtcttgactgcccacccaaccgaa
attacccgccgcaccttgatccataaactggttgaagtgaatacctgcctgagccagttg
gatcacaatgatttagccgattacgaacgcaacaagatcatgcgtcgtttacggcagtta
gttgcacaatcgtggcataccgacgaaattcgcaaactgcgtccctcgcccgttgatgaa
gccaaatggggctttgcggtggtggaaaacagcctgtgggaaggcgtccctgcattcctg
cgtgagtttaacgagcagttagagaactcccttgattaccgtctacccgtggaagcggta
cctattcgctttacttcatggatgggcggtgaccgcgatggtaacccgaatgtaacggct
gaaatcactcgccatgtgctgctactcagccgttggaaagccaccgatttattcctgcgt
gatattcaggtgctggtgtctgaactttctatgtcggaatgtaccccggagctgcgtgaa
ttagccggtggtgaagaggtgcttgaaccttatcgccaactgatgaagaacgttcgtacc
caattgaccaatacccaggcttatctggaagcgcgtctgaaaggcgagcgcgtattgcca
ccacacgatttactggtcagtaatgatcaactgtgggaaccgctctacgcctgctatcaa
tcgctgaaagcctgtggcatggaaatcatcgccaacggtcagttgttggataccctacgc
cgcgtgcgttgttttggtgtgccattggtgcgcattgatgtgcgtcaggaaagtacccgt
cataccgatgctatcgcggagctgacccgttatctgggccttggtgattatgagagttgg
tctgaatcagacaagcaagcctttttggtccgcgaactgaactctaagcgcccactggtt
cctctaaaatgggaacctagcgccgagacacaagaagtgctggaaacctgtcgggtgatt
gctgaagcaccgcaaggttctatcgctgcttacgttatctctatggcgaaagtgccgtca
gacgtgctggccgtgcatttgttactgaaagaagcgggttgcccatttactctacctgtc
gccccgctattcgagaccctcgatgacttgaacaacgctgacgatgtcatgacccagttg
ctgggtatcgattggtatcgtggcctgatccaaggcaagcagatggtgatgattggctat
tctgactcggcaaaagacgccggtgttatggcggcctcttgggcacaataccgggcgcag
gatgcactgattaaaacctgtgagaaagccgggattacgctgacattgttccatggccgt
ggggggtctattggtcgtggcggtgcgccagcccatgcggcattgctctctcagcctccg
ggcagtctgaaaggcggcttacgggttaccgaacaaggcgagatgattcgctttaagttt
gggttaccggaagtcaccatcagcagcctggcgctgtacgcaggtgcaattctggaagcc
aatctgttaccgccaccagagccgaagaaagagtggattgaagtgatggatctgctgtca
gacgcctcttgcgacatgtatcgcagctacgttcgtgaaaatccagagttcgtccgttac
ttccgtgctgcgacaccggaattggaacttggcaagctgcctctgggttcccgcccagcc
aaacgccgcccggacggtggagtggaaagtctgcgggcgatcccatggattttcgcctgg
acacaaaaccgtctgatgctccctgcctggttgggtgccggtgcgggtttgcagagagcg
atcgatgcaggtaagcgagatgtactcgccaccatgtgccgtgactggccgttcttctcg
acccgcattggtatgctggagatggtcttcgccaaagccgatttgtggctggcagaatat
tatgatcagcgtttagtggataaatcgctatggccgttaggtcagcagttacgtgaccaa
ctggcagccgatattaaagtggtgttggctatcgccaacgatgaccatttgatggctgac
ttgccatggattgccgaatccatcgcgttgcgtaacgtgtacaccgatccattaaacgta
ctgcaagccgagctgttgcaccgttcacgccagcaagaacaccctgatgcctgtgttgaa
caagcgttgatggtgaccattgccggtgtggctgcggggatgcggaataccggttag

DBGET integrated database retrieval system