KEGG   Yersinia pseudotuberculosis 1: BZ23_439
Entry
BZ23_439          CDS       T03679                                 

Gene name
phoR
Definition
(GenBank) phosphate regulon sensor kinase PhoR
  KO
K07636  two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
ypc  Yersinia pseudotuberculosis 1
Pathway
ypc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BZ23_439 (phoR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ypc01001]
    BZ23_439 (phoR)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ypc02022]
    BZ23_439 (phoR)
Enzymes [BR:ypc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BZ23_439 (phoR)
Protein kinases [BR:ypc01001]
 Histidine kinases
  OmpR family
   BZ23_439 (phoR)
Two-component system [BR:ypc02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   BZ23_439 (phoR)
SSDB
Motif
Pfam: PhoR HATPase_c HisKA PAS HATPase_c_2 HATPase_c_3 PAS_8 PAS_9 PAS_4
Other DBs
NCBI-ProteinID: AJJ70937
UniProt: A0A3G5KJ25
LinkDB
Position
517497..518813
AA seq 438 aa
MLERLSWKTLALELALFCLPALLLGAFIGYLPWLLLVSVVAALTWNFYNQLKLSHWLWLD
RSMTPPSGRWSWEPLFYGLYQMQLRNRRRRRELALLIKRFRSGAESLPDAVVITTVDGNI
FWCNGLAQQLLGFRWPEDNGQHILNLLRYPEFSQYLQQQTFSRPLTLQLNNGYYVEFRVM
PYSEGQLLMVARDVTQMRQLEGARRNFFANVSHELRTPLTVLQGYLEMMHDQELAGPLRD
KALGTMQEQTKRMDGLVKQLLTLSRIEAAPNVDLNERVDIPLMLKILQHEVQALSNGRHE
ITFRVNDQLKVFGNEDQLRSAVSNLVYNAVNHTPEGTKIEVCWQQTPQGAQFQVSDNGPG
IPPEHVPRLTERFYRVDKARSRQTGGSGLGLAIVKHALSHHDARLEVMSEIGLGTRFIFT
LPNRLIVPTVLVENAVKS
NT seq 1317 nt   +upstreamnt  +downstreamnt
gtgttagaacgcttatcatggaaaacgctggctttagagctggctcttttttgtttgcct
gcattattactgggggcgtttattggttatctcccttggttattgctggtttcagtggtc
gctgcgctgacgtggaacttttataatcaactcaaactctctcattggttgtggcttgat
cgcagtatgacaccgccgtcggggcgttggagttgggaacccctattttacggcttatat
cagatgcaattgcgcaaccgcaggcgtcggcgcgaactggcgcttttaattaagcgtttt
cgcagtggtgcagagtcactgcctgatgccgtagttatcaccacggttgatggtaatatt
ttctggtgtaatggtttagctcaacaattgttggggtttcgctggccagaggataatggg
cagcatattctcaatttattgcgctacccggaatttagccaatatctgcaacaacaaacg
ttttcccgcccactgaccttgcaattgaataacggttactacgtggagtttcgcgtgatg
ccttattctgaagggcagttattgatggtggcccgtgatgtgactcaaatgcgccagttg
gaaggcgcaagacgtaacttttttgccaacgtcagccatgaattacgtacgccgctgacg
gtgctgcaaggctatctggaaatgatgcatgaccaagagttggccgggccgttacgcgat
aaagctttggggacgatgcaagagcagactaagcgtatggatgggctggtgaagcaactt
ttgacattatcacgtatcgaagccgcaccaaatgtggatttaaatgagcgggtggatatt
ccgctgatgttgaaaatattgcagcatgaggtacaggcactgagcaatggccgccatgag
attactttcagggttaacgatcaattaaaggtattcggtaacgaagaccaactgcgtagc
gcggtatcgaatctggtctacaacgctgtaaatcatacgcctgaagggacgaaaattgag
gtctgctggcaacaaacaccacaaggtgctcaatttcaagtcagcgacaacgggccgggg
atccctcctgagcatgttcctcgccttacggagcgcttctatcgggtcgataaagcccgg
tcacggcaaacggggggcagtgggttggggttggcaatcgtgaaacatgctctgagtcac
catgatgcgcgtttggaggtgatgagtgaaattggtctgggtacccgttttatttttacc
ttaccgaacaggttgattgttccaactgttttagtcgagaatgcagtcaaatcttaa

DBGET integrated database retrieval system