KEGG   Yersinia pestis D106004: YPD4_2959Help
Entry
YPD4_2959         CDS       T01832                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase [Cu-Zn] precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ypd  Yersinia pestis D106004
Brite
Enzymes [BR:ypd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YPD4_2959 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ACY59863
LinkDB All DBs
Position
complement(3754280..3754885)
Genome map
AA seq 201 aa AA seqDB search
MKLSTLLLPVILYSSATLAANMAGMNDKASMNDKASMNDMASMNGKASMTVKINESLPQG
NGKALGTVTVTETAYGLLFTPHLTGLAPGIHGFHLHEKPSCAPGMKDGKAVPALAAGGHL
DPNKTGVHLGPYNDKGHLGDLPGLVVNADGTATYPVLAPRLKSLSEVKQHALMIHAGGDN
YSDHPMPLGGGGARMACGVIE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagtacattattgctacctgttattctttactccagcgcaacactggccgct
aacatggctggcatgaatgataaggccagcatgaatgataaggccagcatgaatgatatg
gccagcatgaatggtaaggctagcatgactgtgaaaatcaacgaatcattgccacaaggt
aatgggaaagcgcttggcaccgtgacggtgactgaaaccgcttatggcttactgtttacg
ccacatctcactgggctggctccgggaattcacggtttccatctgcatgaaaaacccagt
tgtgctccggggatgaaagatggcaaggcagtgccagcattggcagccggggggcatctt
gacccaaataagaccggggtacaccttggtccttacaacgataaagggcatctgggggat
ctgccgggattggtggttaatgcagatggcaccgccacctatcccgtattggctccgcgc
ctgaaatcgttgtcagaggtgaaacagcatgcgttaatgatccatgctggcggtgataat
tactctgatcatccaatgcctttaggcggtggtggcgcacggatggcatgtggagtcatt
gagtaa

DBGET integrated database retrieval system