KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO1641Help
Entry
YPO1641           CDS       T00063                                 

Gene name
icdA
Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype00020  Citrate cycle (TCA cycle)
ype00480  Glutathione metabolism
ype01100  Metabolic pathways
ype01110  Biosynthesis of secondary metabolites
ype01120  Microbial metabolism in diverse environments
ype01130  Biosynthesis of antibiotics
ype01200  Carbon metabolism
ype01210  2-Oxocarboxylic acid metabolism
ype01230  Biosynthesis of amino acids
Module
ype_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ype_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ype00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPO1641 (icdA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YPO1641 (icdA)
Enzymes [BR:ype01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     YPO1641 (icdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-GeneID: 1174480
NCBI-ProteinID: YP_002346652
UniProt: Q0WGD6
LinkDB All DBs
Position
1866223..1867476
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMINVVDAAVKKAYNG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYEGTPSPVKHPELTNMVIFRENAEDIYAGIEWKAGSPEAEKVIKFL
REEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKEIIVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDDCALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIIKGTEGAIQAKTVTYDFERLMEGAKLLKCSEFGDAIIKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaagaaaattactgtcgatgctcagggt
aaactggttgttccgcataatccgatcattccatttattgaaggtgacggtattggtgtt
gatgtaaccccggcgatgatcaacgtggtagatgctgcggttaagaaagcttataacggt
gaacgtaaaatttcctggatggaaatttacactggtgagaaatcaacccatgtctatggt
aaagatgtttggttgccagaagaaaccttagatctgatccgtgattatcgcgttgctatc
aaaggcccgttgaccactcctgtcggtggcggcatccgttctttgaacgttgctctgcgt
caacaacttgacctgtatgtgtgtctgcgtccggtgcgttattatgaaggcaccccaagc
ccggtaaaacaccctgaactgaccaacatggtgattttccgtgaaaacgctgaagatatc
tatgcgggtatcgaatggaaagcgggttcacccgaagcagagaaagtgatcaagttcctg
cgtgaagagatgggtgtgaagaaaatccgtttccctgaacaatgtggtatcggtgtgaaa
ccgtgttcagaagaagggactaagcgtttggtacgtgcagcgattgaatatgcaattacc
aacgatcgtgaatcagttacgctggttcataaaggcaatattatgaaattcaccgaaggc
gcgtttaaagactggggttatcagttagcgcgtgaggaatttggtggtgaactgatcgac
ggtggcccatgggttaaaatcaaaaacccaaataacggcaaagaaattatcgttaaagat
gtgattgccgatgctttcctgcaacagatcctgctgcgtcctgcggaatatgatgttatc
gcttgtatgaacctgaacggtgattacatctctgatgcattggcagctcaggttggcggt
attggtattgctccgggggctaacattggtgatgactgcgcactgttcgaagccactcac
ggtactgcaccaaaatatgctggtcaggataaagtgaacccaggttctattattctttca
gcagaaatgatgctgcgtcacatgggctggtttgaagccgctgacttaatcattaaaggc
actgaaggcgcaattcaagccaagaccgtgacttatgatttcgaacgtctgatggaaggc
gctaagttgttgaagtgtagtgagtttggcgacgccattattaagcacatgtag

DBGET integrated database retrieval system