KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2176Help
Entry
YPO2176           CDS       T00063                                 

Gene name
tdk
Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype00240  Pyrimidine metabolism
ype01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ype00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    YPO2176 (tdk)
Enzymes [BR:ype01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     YPO2176 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-GeneID: 1175011
NCBI-ProteinID: YP_002347150
UniProt: Q8ZEJ1
LinkDB All DBs
Position
2449305..2449895
Genome map
AA seq 196 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRFGVGTVSSRIGLSSQAQ
LYNSGTSLLSIIAAEHQDTPIHCILLDECQFLTKEQVQELCQVVDELHLPVLCYGLRTDF
LGELFPGSKYLLAWADKLVELKTICHCGRKANMVLRLDEQGRAVHNGEQVVIGGNESYVS
VCRRHYKEAIKAACCS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttacttttattactctgcaatgaacgcggggaaatccacagcacttcta
cagtcctcatataactaccaagaacgaggtatgcgcaccttggtgtttacggctgagata
gataaccgctttggtgtcggaacggtaagttcacgcattggcctctcttctcaggcccag
ctctataatagcgggacatcattgttatctattatcgccgctgagcaccaggacacacct
attcattgtattctattggatgaatgtcaatttctgactaaagagcaggtccaggaactc
tgtcaggttgttgatgaattacatcttcctgttctttgctacggcctgcggactgatttt
ctcggcgaattatttcccggtagtaaatatttactggcgtgggcggacaaattagtggag
ttgaaaaccatttgtcattgcggtcgtaaagcaaacatggttcttcgcctggatgagcag
gggagagcggtacacaatggtgaacaggtcgttattggtggcaatgaaagctatgtttct
gtctgccgccgccattataaagaagcaattaaagccgcctgctgttcgtag

DBGET integrated database retrieval system