KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2309
Entry
YPO2309           CDS       T00063                                 

Gene name
rstB
Definition
(RefSeq) sensor protein RstB
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ype00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YPO2309 (rstB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ype01001]
    YPO2309 (rstB)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ype02022]
    YPO2309 (rstB)
Enzymes [BR:ype01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     YPO2309 (rstB)
Protein kinases [BR:ype01001]
 Histidine kinases
  OmpR family
   YPO2309 (rstB)
Two-component system [BR:ype02022]
 OmpR family
  RstB-RstA
   YPO2309 (rstB)
SSDB
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_2 HATPase_c_3 HATPase_c_5
Other DBs
NCBI-GeneID: 1175141
NCBI-ProteinID: YP_002347276
UniProt: Q0WEL2
LinkDB
Position
2596225..2597502
AA seq 425 aa
MLLFVCFMVMAMLVGLVYKVTAERAGRQSLDDLMKSSLSLMRSELREIPLKDWNKTIATL
DLNLSFQLHIEPLDKRDLGAQLNKRLRAGEIIALDDEYTFLQRIPRSHYVLAVGPVPYLF
YLHQMRLLDLALLILIGLSLALPVFLWMRPHWKDLLKLENAAQRLGSGHLDERTHFDPTS
SLSRLGVAFNQMADNINTLIVSKKLLIDGIAHELRTPLVRLRYRLAMSDNLTESEQQALH
HDIGQLEALIDELLTYARLDRPQVSLNLEPIDLPAWLTTKIMDIRSIHQEREIELDIPHR
GDFGAVDLRLMERVLDNLVNNALRYSHQRLRIGLWFDGDNACLQVEDDGPGIPPEERTRI
FEPFVRLDPSRDRATGGCGLGLAIVHSIALAYQGSISVNTSPLGGASFRFSWPIKTHLPL
SADQN
NT seq 1278 nt   +upstreamnt  +downstreamnt
ttgttgttattcgtttgcttcatggtgatggcgatgctggttggcctggtttataaggtc
accgctgagcgcgcgggtcgtcagtctttagatgacctgatgaaaagttcactatcactg
atgcgcagcgaattgcgggagatcccgctaaaagactggaataaaaccatcgcaacatta
gatttaaatctttcttttcaacttcatatcgaaccattagataaacgtgatcttggcgca
caattgaacaaacggctacgtgcgggtgaaattattgcattggatgatgaatataccttc
ctgcaacgtatccctcgtagccactatgttctggcggttggcccggtcccttatctattt
tatttacaccagatgaggctgctcgatttagcattattaatcttgattggcctgtcgtta
gctcttccggtatttctctggatgagaccgcactggaaagatcttctcaaattagaaaat
gccgctcagagactgggctcaggccaccttgacgagcggactcatttcgaccccacttcc
agtctaagccgtttaggcgtggcttttaaccaaatggctgacaacatcaacaccctgatt
gttagcaaaaaattactgattgatggtatagcacacgaactacggacaccattggtacgc
ttacgttatcgattagcgatgagtgataacctgaccgaaagcgaacagcaggcgttacat
catgatatcggtcaattggaagcacttattgatgaactactgacctatgcacgtttggat
cgcccacaagtttccctcaatctggaacctatcgacctaccggcctggctaacaaccaaa
atcatggatatccgctcgattcatcaagagcgtgagatcgaacttgatattccccaccgt
ggtgattttggtgccgttgacctgcgtctgatggagcgagtgctggataacctggtcaat
aatgccctacgctattcacatcaacggctgcgcatagggttatggttcgatggcgataac
gcctgcctacaggttgaagatgacggccccggtatcccgccagaagaacggacacgaatt
tttgaaccctttgttcgtttagaccccagccgtgatcgcgccactggtggctgtggattg
gggctggccattgtccattcgattgcactggcctatcaaggcagtatctctgtcaatacc
agtccattaggtggggccagtttccgctttagttggccgataaaaacacatttgcctcta
tccgctgatcagaattaa

DBGET integrated database retrieval system