KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2367Help
Entry
YPO2367           CDS       T00063                                 

Gene name
gst
Definition
(RefSeq) glutathionine S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype00480  Glutathione metabolism
ype01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ype00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YPO2367 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ype02000]
    YPO2367 (gst)
Enzymes [BR:ype01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     YPO2367 (gst)
Transporters [BR:ype02000]
 Other transporters
  Pores ion channels [TC:1]
   YPO2367 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-GeneID: 1175199
NCBI-ProteinID: YP_002347333
UniProt: Q0WEF5
LinkDB All DBs
Structure
PDB: 

Position
2660143..2660748
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLSPHIVLREAGLDFSIERVDLVTKKTETGADYLSINPKGQVPALVLDDG
SLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFIATELHKGFSPLFNPNTPDE
YKTIVRERLDKQFSYVDSVLAEHDYLLGKKFSVADAYLFTVSRWANALNLQIKERSHLDQ
YMARVAERPAVKAALAAEDIK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaaccgggtgcttgttctctgtccccccatattgtgttgcgggaa
gcaggactagatttcagcattgaacgtgttgatttagtgacaaaaaagactgaaacgggt
gcagactatttaagcatcaaccccaaaggacaagtaccggctttagtgctggatgacggt
agcctactgactgaaggggtagctattgtgcaatatttggcagataaagtcccagaccgc
cacttgattgccccatcagggacgctctcgcgctatcatgccattgagtggctgaatttt
atcgcgactgaactacataaaggttttagcccactatttaacccaaatacaccggatgag
tataagacgattgtccgcgagcggctggataagcaattcagctacgttgatagcgtatta
gcagagcatgattatctactaggtaaaaaattcagtgtggcagatgcctacttatttacc
gttagccgttgggctaatgcgttaaatcttcaaatcaaagaacgcagccatttggatcaa
tatatggcgcgggtcgctgaacgccctgcggtaaaagcagctttagccgccgaagatatc
aagtaa

DBGET integrated database retrieval system