KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2844Help
Entry
YPO2844           CDS       T00063                                 

Gene name
goaG
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype00250  Alanine, aspartate and glutamate metabolism
ype00410  beta-Alanine metabolism
ype00640  Propanoate metabolism
ype00650  Butanoate metabolism
ype01100  Metabolic pathways
ype01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ype00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    YPO2844 (goaG)
   00650 Butanoate metabolism
    YPO2844 (goaG)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YPO2844 (goaG)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YPO2844 (goaG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ype01007]
    YPO2844 (goaG)
Enzymes [BR:ype01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     YPO2844 (goaG)
Amino acid related enzymes [BR:ype01007]
 Aminotransferase (transaminase)
  Class III
   YPO2844 (goaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 1175669
NCBI-ProteinID: YP_002347782
LinkDB All DBs
Position
complement(3174550..3175863)
Genome map
AA seq 437 aa AA seqDB search
MAYQQERIMSHRELEQRRKEATPRGIGVLCDFYAVRAENATLWDEQGREYIDFTAGIATL
NIGHRHPKVMAAVRQQLDQFTHTAYQVVPYASYVTLAEKINSLAPISDSNMTAAGNSKTA
FFTTGVEAIENAVKIARAATGRPGVIAFSGAFHGRTLLAMALTGRAVPYKVGFGPFPASI
FHALYPNELYGVSVEEAISSVERLFRCDISPTQVAAILFEPIQGEGGFNIAPPEFVSALR
TLCDEHGILLIADEVQTGFARTGKLFAMEYYPDTKVDVITMAKSLGGGMPISAVTGRADI
MDAPLPGSLGGTYAGNPLAVAASLAVLDIIAEEKLCERALILGAKLVDVLEKAQMSNAAI
VGIRARGSMVAVEFNDPVSGKPSPELTRAYQRQALEEGLLLLSCGVHSNVIRFLYPLTIP
DKQFKQAMNILTRLLAS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcataccagcaggagcgaatcatgagtcaccgtgaattggaacaacgcagaaaagag
gcgaccccacgtgggattggtgtgttatgtgatttctatgcggtacgggctgaaaatgcc
acgctgtgggatgaacaggggcgggaatatatcgattttacggcgggtattgcgacactc
aatatcggacaccgccacccgaaagtgatggccgctgtgcgccaacaactggaccagttt
acccatactgcctatcaggtggtgccttacgccagttatgtcacattggcagagaaaatt
aattcgctagcccctatttctgattcaaatatgacggcagcgggcaacagtaaaaccgct
tttttcaccactggggtcgaagcgatagaaaatgccgtgaaaatagcgcgtgcggcgact
ggccgccctggtgtgattgctttctccggggcatttcatggccgaaccttattggcgatg
gcgttgaccggtagagcggtgccgtacaaagtcggttttggtccgttccctgcctccatt
tttcacgccctctatcccaatgagttgtatggcgtgagtgtcgaagaggccatcagcagt
gttgagcgcctgtttcgttgtgatatcagtccgacacaagtggcggccattctatttgag
ccgattcagggcgagggcggttttaatatcgccccgccggaatttgtcagtgctttgcgc
accctgtgtgatgagcacggtattttgctgattgccgatgaagtacaaacggggtttgcc
cgtacaggcaagttatttgccatggaatattatcccgacaccaaagttgatgtgatcacc
atggcgaaaagccttgggggcggtatgccaatttccgcggtcacgggtcgggccgacatt
atggatgccccgttgccggggagtttgggcggtacttatgccggtaacccactggcggtg
gctgcgtcactggcggtgctcgatattattgctgaagagaagttatgcgagcgcgccctg
attttaggcgcgaagttggttgacgtactggaaaaagcccaaatgagcaatgcggccatt
gtgggcattcgtgcgcgtggatccatggtggcggtggaatttaacgatcccgtcagcggt
aaaccgtcaccagaactgacgcgcgcctatcaacgtcaggcactggaagaggggctgtta
ctcctgagttgcggtgtccacagcaacgtgatccgcttcctctacccattgaccattccc
gacaagcaatttaaacaggcgatgaatattcttacccgcctactggcgagctaa

DBGET integrated database retrieval system