KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO3313Help
Entry
YPO3313           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype00030  Pentose phosphate pathway
ype01100  Metabolic pathways
ype01110  Biosynthesis of secondary metabolites
ype01120  Microbial metabolism in diverse environments
ype01130  Biosynthesis of antibiotics
ype01200  Carbon metabolism
ype01230  Biosynthesis of amino acids
Module
ype_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ype_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ype00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YPO3313
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    YPO3313
Enzymes [BR:ype01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     YPO3313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_C Transket_pyr PFOR_II TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 1176132
NCBI-ProteinID: YP_002348209
UniProt: A0A384KG39
LinkDB All DBs
Position
complement(3694861..3695805)
Genome map
AA seq 314 aa AA seqDB search
MSNAEHLASVMVEQFIKAVDNGVDLVPVVADSTSTAKIGPFITRFPDRVVNVGIAEQAMV
GMAVGLSMGGKIAVTCNAAPFLISRANEQLKIDVCYNNSNVKLFGLNSGASYGPLASTHH
CIDDIAILRGFGNIEIYAPADPQECRQIIDYALAHQGPVYIRLDGKALPPLHDEHYRFAP
GQIDVLQEGRDIALVAMGSTVHEAVSAAAILADNNISAAVVNVSSIRPCDTQQLFAILQQ
SQRVITIEEHNINGGVGSLVAEVLAEAGSGTPLVRLGIPDGGYAIAADRAEMRAYHGFDA
AGIVARALRFCRGE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgcagaacatttggcctcagtgatggtcgagcagtttatcaaggcggtcgat
aacggcgttgatttggtccccgtggttgctgactcgacttcaacggcaaaaattgggccg
tttatcacacgcttccctgatcgggtggtcaacgttgggattgccgaacaggcgatggtg
ggcatggcggtcggcctatccatgggggggaaaattgcggtgacctgtaatgccgcaccg
tttctgatttcgcgtgctaacgagcagttgaaaattgatgtttgttacaacaacagcaat
gtaaaactgttcggtttgaactccggtgccagctacgggccactggccagtacacatcac
tgtatcgatgacatcgccatcctacgtggcttcggtaatatcgaaatctacgcccctgct
gatccccaggagtgccgtcagatcattgattatgcgttggcccatcagggtccggtatat
attcggttggatggtaaagcgttgccgccactgcatgatgagcattatcgatttgctccc
ggtcaaattgatgtcttgcaagagggacgggatattgctctggtcgcgatgggatctaca
gtacatgaagcggtcagcgcggcagccatactggcagacaacaatatttctgctgcggtg
gtcaacgtttcctctatccgcccgtgtgatactcagcaactgttcgccatcctccaacag
agtcagcgggtgattaccatagaagagcacaatattaatggcggcgtggggagtctggtc
gcggaagtgctggctgaggcggggagtggtactccattagtgagactgggtattcctgac
ggtggttatgcgattgccgctgatcgggctgagatgcgtgcctatcatggttttgatgcg
gcaggcattgtggctcgtgctctgcggttttgccgaggggaataa

DBGET integrated database retrieval system