KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO3452Help
Entry
YPO3452           CDS       T00063                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ype00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    YPO3452
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ype02000]
    YPO3452
Transporters [BR:ype02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    YPO3452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_16 NACHT RsgA_GTPase IstB_IS21 Mg_chelatase AAA_29 DUF87 AAA_7 DUF815 RNA_helicase
Motif
Other DBs
NCBI-GeneID: 1176269
NCBI-ProteinID: YP_002348341
UniProt: A0A384LBX1
LinkDB All DBs
Position
3858901..3859779
Genome map
AA seq 292 aa AA seqDB search
MTDSIFTVDNLCVDFQQQRVVDNISFHLGHERVALVGESGSGKSITARALMGLVRHPGKV
SAKKLSYYSDNTDDQGHSGQIIEHDLLRLNTRQWSALRGSEIAMVLQDPRYALNPVQPVG
KQIEESLLLHNTLSSADAHERVLNALASVGLNASAYHSYPGQLSGGMGQRAMLAIALVNN
PRVLIADEPTSALDAKLRNQILELIVEQTEQRKMSLLLISHDLPLVAEHCHRVLVMYQGK
LVDQGLAADLPHSTHPYTHTLWACRPNAHTYGTDLPVLDRSVDFSGGSRGTD
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgactgattctatttttaccgtcgataacctgtgcgtcgattttcagcaacagcgggtg
gtggataacatttcgttccacctcggtcacgaacgtgttgctctcgtaggcgaatccggc
tccgggaaatcgatcacggccagagcgctgatgggcttagtcaggcaccccggtaaagtc
agtgccaagaagctgagttattactctgacaacacggatgatcagggccattccggtcag
attattgaacacgatttactgcgcctaaacaccaggcaatggagcgcattacggggcagt
gaaattgctatggtgttacaagacccccgttatgccttaaatccggtacaacctgttggt
aagcagattgaagagtctctgttgctgcataacaccctttcaagcgctgatgcgcatgaa
cgggtattaaatgcactggcctcggttgggttaaatgccagcgcttaccacagctacccc
ggccagctttctggtggtatggggcaacgcgcgatgctggcaatcgctttggtgaataat
cccagagtattaattgccgatgaaccgacatccgcgttagatgccaaattacgcaaccag
atccttgaattaattgttgagcaaaccgaacaacgaaaaatgagcctgttgctgatcagc
catgacctgccattagtcgccgaacattgtcatcgcgtgttagtgatgtatcaggggaag
ttggtcgatcaaggtctggccgctgatctgccccattcaacccacccttatacccacacg
ctatgggcttgccgcccgaatgcccatacctatggcaccgatctgccagtattggatcgc
agcgtagatttctccggaggctcccgtggcactgattga

DBGET integrated database retrieval system