KEGG   Yersinia pseudotuberculosis PA3606: BZ19_1758Help
Entry
BZ19_1758         CDS       T03846                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ypf  Yersinia pseudotuberculosis PA3606
Pathway
ypf00473  D-Alanine metabolism
ypf01100  Metabolic pathways
ypf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ypf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BZ19_1758 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BZ19_1758 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ypf01011]
    BZ19_1758 (alr)
Enzymes [BR:ypf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BZ19_1758 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ypf01011]
 Precursor biosynthesis
  Racemase
   BZ19_1758 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AJK16285
LinkDB All DBs
Position
1954839..1956068
Genome map
AA seq 409 aa AA seqDB search
MHVRFRHLFLLPLITLVACSQPVSKNHLSLTSLSANAQQPVVNNAWLEISQGALDFNTKK
MLTLLDNKSTLCAILKGDAYGHDLTLVTPVMLKNNVQCIGVASNQELKTVRDLGFTGQLI
RVRSATLKEMQQAMAYDVEELIGDKTVAEQLNNIAKLNGKVLRIHLALNSAGMSRNGLEV
SKARGLNDAKTIAGLKNLTIVGIMSHYPVEDASEIKADLARFQQQAKDVIAVTGLKREKI
KLHVANTFATLAVPDSWLDMVRVGGVFYGDTIASTEYKRVMTFKSNIASLNNYPKGGTVG
YDRTYTLKRDSLLANIPVGYADGYRRVFSNAGHVIIQGQRLPVLGKTSMNTVIVDVTDLK
KVSLGDEVVLFGKQGNAEIQAEEIEDLSGALFTEMSILWGATNKRILVD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcacgttcgttttcgtcatttattcttattaccattaataactttggtcgcttgtagc
caacccgtatcaaaaaaccatcttagcctgacctcactatctgccaacgcccagcaacct
gtagtaaataatgcgtggcttgaaatctctcaaggtgcgctggatttcaatactaaaaag
atgcttacactgctggataataaatccacactttgtgcaatattaaaaggtgatgcctat
ggacatgacctgaccttagtcacaccggtgatgctaaaaaacaatgtgcaatgtattggg
gttgccagcaatcaggaactaaaaacggtacgtgatctaggatttacgggtcagttgata
cgggtcagaagtgcaacattaaaagaaatgcaacaagctatggcttacgatgttgaagaa
cttattggcgataaaaccgtcgctgagcagttaaataatattgcaaaactgaatggaaaa
gttctgcgtatccatctggcactgaactccgcagggatgtctcgtaatgggctggaggtc
agtaaggcccgcggtttaaatgacgcaaagacaattgcaggtttaaaaaatctgacaatc
gttggcatcatgtcgcactacccggtggaagatgctagcgaaatcaaagcagacttggct
cgattccagcaacaagccaaagatgttatcgcggtcacggggctaaaacgtgaaaagatt
aagctccacgtcgccaatacattcgcgaccttagcggtgcctgattcatggttggatatg
gtccgtgtgggaggggtgttttatggtgacaccatcgccagcacagagtataagcgggtc
atgaccttcaaatctaacatcgcatcgctgaacaactaccctaagggcggtactgttggc
tatgaccggacctatacattgaaacgtgattccctgctggcgaatatccccgtgggttat
gccgatgggtatcgccgagtatttagtaatgcggggcatgtgattattcaaggtcagcgc
ctgcccgtattaggcaaaacatcaatgaatacggtcatagtagacgtcaccgatctgaaa
aaagtgagtttaggtgatgaagttgtcttgttcggtaagcaaggcaatgcggaaattcag
gcagaagaaattgaagatctcagtggcgcactctttaccgaaatgtcaattctgtggggc
gcaaccaataagcgtattctggtagattaa

DBGET integrated database retrieval system