KEGG   Yersinia pestis Angola: YpAngola_A0978Help
Entry
YpAngola_A0978    CDS       T00635                                 

Gene name
sodC
Definition
(GenBank) copper/zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ypg  Yersinia pestis Angola
Brite
Enzymes [BR:ypg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YpAngola_A0978 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABX87850
LinkDB All DBs
Position
complement(999005..999574)
Genome map
AA seq 189 aa AA seqDB search
MKLSTLLLPVILYSSATLAANMAGMNDKASMNGKASMTVKINESLPQGNGKALGTVTVTE
TAYGLLFTPHLTGLAPGIHGFHLHEKPSCAPGMKDGKAVPALAAGGHLDPNKTGVHLGPY
NDKGHLGDLPGLVVNADGTATYPVLAPRLKSLSEVKQHALMIHAGGDNYSDHPMPLGGGG
ARMACGVIE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagtacattattgctacctgttattctttactccagcgcaacactggccgct
aacatggctggcatgaatgataaggccagcatgaatggtaaggctagcatgactgtgaaa
atcaacgaatcattgccacaaggtaatgggaaagcgcttggcaccgtgacggtgactgaa
accgcttatggcttactgtttacgccacatctcactgggctggctccgggaattcacggt
ttccatctgcatgaaaaacccagttgtgctccggggatgaaagatggcaaggcagtgcca
gcattggcagccggggggcatcttgacccaaataagaccggggtacaccttggtccttac
aacgataaagggcatctgggggatctgccgggattggtggttaatgcagatggcaccgcc
acctatcccgtattggctccgcgcctgaaatcgttgtcagaggtgaaacagcatgcgtta
atgatccatgctggcggtgataattactctgatcatccaatgcctttaggcggtggtggc
gcacggatggcatgtggagtcattgagtaa

DBGET integrated database retrieval system