KEGG   Yersinia pestis Angola: YpAngola_A2552Help
Entry
YpAngola_A2552    CDS       T00635                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00480  Glutathione metabolism
ypg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YpAngola_A2552
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypg02000]
    YpAngola_A2552
Enzymes [BR:ypg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     YpAngola_A2552
Transporters [BR:ypg02000]
 Other transporters
  Pores ion channels [TC:1]
   YpAngola_A2552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: ABX88298
LinkDB All DBs
Structure
PDB: 

Position
2669792..2670397
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLSPHIVLREAGLDFSIERVDLVTKKTETGADYLSINPKGQVPALVLDDG
SLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFIATELHKGFSPLFNPNTPDE
YKTIVRERLDKQFSYVDSVLAEHDYLLGKKFSVADAYLFTVSRWANALNLQIKERSHLDQ
YMARVAERPAVKAALAAEDIK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaaccgggtgcttgttctctgtccccccatattgtgttgcgggaa
gcaggactagatttcagcattgaacgtgttgatttagtgacaaaaaagactgaaacgggt
gcagactatttaagcatcaaccccaaaggacaagtaccggctttagtgctggatgacggt
agcctactgactgaaggggtagctattgtgcaatatttggcagataaagtcccagaccgc
cacttgattgccccatcagggacgctctcgcgctatcatgccattgagtggctgaatttt
atcgcgactgaactacataaaggttttagcccactatttaacccaaatacaccggatgag
tataagacgattgtccgcgagcggctggataagcaattcagctacgttgatagcgtatta
gcagagcatgattatctactaggtaaaaaattcagtgtggcagatgcctacttatttacc
gttagccgttgggctaatgcgttaaatcttcaaatcaaagaacgcagccatttggatcaa
tatatggcgcgggtcgctgaacgccctgcggtaaaagcagctttagccgccgaagatatc
aagtaa

DBGET integrated database retrieval system