KEGG   Yersinia pestis Angola: YpAngola_A3156
Entry
YpAngola_A3156    CDS       T00635                                 

Definition
(GenBank) putative decarboxylase
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00230  Purine metabolism
ypg00240  Pyrimidine metabolism
ypg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YpAngola_A3156
   00240 Pyrimidine metabolism
    YpAngola_A3156
Enzymes [BR:ypg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     YpAngola_A3156
    3.2.2.-  
     YpAngola_A3156
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: ABX88216
LinkDB
Position
complement(3342966..3344330)
AA seq 454 aa
MITHVSPLGSMDLLSQLEVDMLKRTASSDLYRLFRNCSLAVLNSGSLTDNSKELLSRNET
FDINVLRRERGVKLELVNPPEHAFVDGKIIRSLQANLFAVLRDILFVNGQIVSASNFQHL
NMESSSHLTNLVFSILRNARALHIDEEPNMVVCWGGHSINETEYLYARKVGSQLGLRELN
ICTGCGPGAMEAPMKGAAVGHAQQHYKKGRFIGMTEPSIIAAEPPNPLVNELVIMPDIEK
RLEAFVRIAHGIIIFPGGVGTAEELLYLLGILMNPENSEQVLPLILTGPKESADYFKVVD
EFIMNTLGDGARKYYQIIIDDPDEVARQMKKAMPLVKEYRRNTGDAYSFNWSIRIEPDLQ
HPFEPNHENMANLDLSHNQPPEKLAAALRRAFSGIVAGNVKEVGIQAIEAHGPFKLHGDP
QLMKQMDRLLQDFIAQHRMKLPGSVYTPCYEICS
NT seq 1365 nt   +upstreamnt  +downstreamnt
ttgattacacatgtcagcccgctcggctcaatggatctgttatcacagctcgaagtggat
atgctcaaacgtaccgccagcagtgatttgtaccgtttattccgtaattgttcactggct
gttctcaattcaggtagcctgaccgataacagcaaagagttgttatctcgcaatgaaacc
tttgatatcaacgtgcttcgccgtgagcgaggagttaaactcgagttggtcaacccacca
gaacatgcgtttgttgacggcaaaattattcgctcattacaagcaaacctgttcgcggta
ttacgcgatatcttatttgtcaatggtcaaatcgtcagtgcgagcaacttccagcatttg
aatatggagagctccagtcatttgactaacctggtcttttctattttacgtaatgcccgt
gccctacatattgatgaagaacccaatatggtcgtgtgctggggagggcattcaattaat
gaaaccgagtatttgtacgcccgtaaagtgggcagccaactgggtttgcgtgaattaaat
atctgtaccggctgtggtccgggtgccatggaagccccgatgaaaggtgccgctgtcgga
catgctcagcaacattataaaaaaggccgttttatcggcatgacagaaccgtccattatc
gctgcagaaccaccaaaccctctggttaatgaactggttatcatgcccgatattgagaag
aggctggaagccttcgtccgaatcgctcatggcatcattattttcccaggtggggtgggc
acagcagaagaattactctatctattagggattttgatgaatccggaaaatagtgagcaa
gtgctgccgctgattttaaccgggccaaaagagagtgcggattacttcaaagtggtggat
gagttcatcatgaatacgctgggtgatggcgctcgtaaatactatcagataattattgat
gacccagacgaagtcgcccgtcagatgaagaaagcgatgccactggtgaaagagtatcgc
cgtaataccggcgatgcttatagcttcaactggtctattcgtattgaaccagatttacag
catccgttcgaaccaaaccatgaaaatatggctaatctggatctgtctcataatcaacca
ccggagaaactggccgccgcattacgccgggcgttttctgggattgtggcaggtaatgtc
aaggaagtgggtatccaggctattgaagcgcatgggccatttaaactgcatggcgatccg
caattaatgaagcaaatggaccgcctactgcaagattttattgctcaacatcggatgaag
ttaccaggtagcgtctatacaccttgctatgaaatttgtagctga

DBGET integrated database retrieval system