KEGG   Yersinia pestis Angola: YpAngola_A3490Help
Entry
YpAngola_A3490    CDS       T00635                                 

Gene name
ptsG
Definition
(GenBank) PTS system, glucose-specific IIBC component
  KO
K02778  PTS system, glucose-specific IIB component [EC:2.7.1.199]
K02779  PTS system, glucose-specific IIC component
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00010  Glycolysis / Gluconeogenesis
ypg00520  Amino sugar and nucleotide sugar metabolism
ypg01100  Metabolic pathways
ypg02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ypg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YpAngola_A3490 (ptsG)
   00520 Amino sugar and nucleotide sugar metabolism
    YpAngola_A3490 (ptsG)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    YpAngola_A3490 (ptsG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypg02000]
    YpAngola_A3490 (ptsG)
Enzymes [BR:ypg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.199  protein-Npi-phosphohistidine---D-glucose phosphotransferase
     YpAngola_A3490 (ptsG)
Transporters [BR:ypg02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component
    YpAngola_A3490 (ptsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC PTS_EIIB MscS_TM
Motif
Other DBs
NCBI-ProteinID: ABX88560
LinkDB All DBs
Position
complement(3705199..3706632)
Genome map
AA seq 477 aa AA seqDB search
MFKNAFANLQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPSVVSHVMAEAGGSVFANMP
LIFAIGVALGFTNNDGVSALAAVVAYGIMVKTMAVVAPLVLHLPAEEIATKHLADTGVLG
GIIAGSVAAYMFNRFYRIQLPEYLGFFAGKRFVPIISGFTAIFLGILLSFIWPPIGKAIQ
IFSEWAAYQNSVVAFGIYGVVERSLVPFGLHHIWNVPFQMQIGEYTNAAGQVFNGDIPRY
MVGDPTAGKLSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPI
EFSFMFVAPILYFIHAILAGLAFPICILLGMRDGTSFSHGLIDFVVLSGNSSRIWLFPLV
GICYGLVYYTIFRVLITKLNLKTPGREDSSTEQSVQGGTEMSAALVEAFGGKDNITNLDA
CITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTDMDEYIRNH
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagaacgcatttgcaaacctgcaaaaggtaggtaaatcgctaatgctaccggta
tccgtgttgcccatcgcaggtattctgctgggtgtcggttccgcgaattttagctggcta
ccgtcggtagtctctcacgtaatggcagaagccggtggttccgtctttgctaacatgcca
ttgatttttgctattggtgttgcgcttggctttaccaacaacgacggtgtatctgcgttg
gcggcggttgtggcttacggcatcatggtaaaaaccatggcggtagtcgcacctctggtc
ttgcatctgccagcagaagaaattgcgactaagcatttagctgataccggggtattgggc
gggattattgccggttcggttgccgcctatatgtttaaccgtttctaccgtattcagtta
ccagaatatttgggcttctttgcgggcaaacgttttgtgccgattatctccgggtttacc
gcgattttcttaggcatactgctgtccttcatctggccacctatcggcaaagctatccaa
attttctccgagtgggcggcttatcagaactcggtcgtcgcttttggtatttacggcgtt
gttgaacgttcattggtaccattcggtctgcaccatatctggaacgtgccattccaaatg
caaattggtgagtacaccaacgcagcgggtcaggtattcaacggtgatatcccacgttat
atggtgggtgacccaacagcgggtaagttatcggggggtttcctgtttaaaatgtacggt
ctgccagcggcagccattgcgatttggcattcagccaaaccagaaaaccgtgcaaaagtg
ggcgggatcatgatctcggcagcactgacatcattcctgaccggtattaccgagccaatc
gaattctcctttatgttcgtggcaccaattttgtattttatccatgcaatcttggcaggt
ttggccttcccaatctgtattctgttagggatgcgtgatgggaccagtttctctcatggc
ttgattgattttgttgtcctgagcggtaacagcagccgtatctggttgttccctctggta
ggtatctgctacggtctggtgtattacaccatcttccgtgtattgattactaaactgaat
ttgaaaacaccgggacgtgaagattcgtctactgagcaatcagtacagggtggcacagaa
atgtcagccgctctggttgaagcatttggtggtaaagacaacattactaacctggatgct
tgtatcactcgccttcgtgttagcgtggcagatgtgtccaaggttgatcaggctgggctg
aagaagttaggtgctgcgggtgttgttgtggcaggctctggtgttcaggctatcttcggt
accaaatctgacaacctgaaaactgatatggacgaatacattcgtaaccattaa

DBGET integrated database retrieval system