KEGG   Yersinia pestis Harbin 35 (biovar Medievalis): YPC_0080Help
Entry
YPC_0080          CDS       T01874                                 

Gene name
mrcA
Definition
(GenBank) Multimodular transpeptidase-transglycosylase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
yph  Yersinia pestis Harbin 35 (biovar Medievalis)
Pathway
yph00550  Peptidoglycan biosynthesis
yph01100  Metabolic pathways
yph01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:yph00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YPC_0080 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    YPC_0080 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:yph01003]
    YPC_0080 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:yph01011]
    YPC_0080 (mrcA)
Enzymes [BR:yph01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     YPC_0080 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     YPC_0080 (mrcA)
Glycosyltransferases [BR:yph01003]
 Polysaccharide
  Bacterial polysaccharide
   YPC_0080 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:yph01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   YPC_0080 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase DUF3502
Motif
Other DBs
NCBI-ProteinID: ADV96851
LinkDB All DBs
Position
complement(88075..90630)
Genome map
AA seq 851 aa AA seqDB search
MKFVKYFLILAVCCILLGAASIFGLYKYIEPQLPDVATLKDIRLQTPMQVYSAEGELIAQ
FGEKRRIPLTLNQIPPEMVHAFIATEDSRFYDHHGVDPVGILRAVSIAMLSGRASQGAST
ITQQLARNFFLSPERTLMRKIKEAFLAIRIEQMLTKDEILELYLNKIYLGYRAYGVGAAA
QVYFGKEVHELTLSQIAMIAGLPKAPSTFNPLYSHDRAVARRNVVLLRMLDEKYITQAQY
DQARSEELVANYHVPQIAFSAPYLAEMVRQEMIKRYGENAYTDGYQVYTTITRKLQLAAV
DSLRANVLAYDMRHGYRGPSNVLWKVGESAWSREQIIDSLKALPVYGPLLPAVVTEADAA
QATAMLADGSNVTLPMVGIRWARPFKSDNAQGPVPKKATDVVQPGQQIWVRKVDDNWWLA
QVPDVNSALVSIDPNNGAIKALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGL
TLATILNDLPITRWDSGAGTDWRPKNSPPTYDGPIRLRQGLGQSKNVVMVRAMRAMGVDY
AAEYLQRFGFPAQNIVHSESLALGSASFTPLQLVRGYAVLANGGYLVDPYFITKITDDVG
NVLFETKPKVVCDNCNLPVIYGDTQRSVVLSDDNIENVATSQNQNASNVPMPELEQVTPA
QTTLNSEQQYAPHVISTPLAFLMRDALNSNIFGEPGWMGTGWRAGRDLKRKDIGGKTGTT
NSSKDAWFSGYGPDTVTSVWIGFDDHRRNLGRSTASGAIPDQISGAEGGAKTAQPAWNDF
MKVALEGLPEKQVPPPPGIVSVVIDKQTGKLSNGGPGSRSEYFIDGTQPTEHTVHEVGTT
LMDNGQTHELF
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcgtaaagtattttttaatccttgcggtgtgttgcattttactgggagcagcc
tcgatatttggcctgtacaaatatattgagccgcagctacccgatgttgccacgctgaaa
gacatccggctgcaaacacctatgcaggtgtatagcgccgaaggcgaattgatcgctcaa
ttcggcgaaaaacgtcgtatcccattgacgttgaatcaaataccaccagaaatggtgcat
gcgtttatcgccacagaagacagccgtttttacgatcatcacggtgtcgaccctgtgggg
atcctgcgtgcagtctctatcgccatgttgtctggtcgcgcctcccaaggggcgagtacc
attacccagcaattggcgaggaacttctttttaagccctgaacggactttgatgcgaaaa
atcaaggaagcatttctggctatccgcatcgaacagatgctgaccaaagatgaaatcctt
gagctgtatctgaacaaaatttatctcggttaccgcgcctatggtgtcggtgctgcggcc
caagtctatttcggcaaagaagtccatgaattgaccctcagccaaatagcgatgatcgcc
gggttacctaaagcgccttctacgtttaacccgctctactcacatgacagagccgtggca
cggcgtaatgtggtgctgctacgtatgctggatgaaaaatacatcactcaggcgcaatac
gatcaagcccgcagtgaagagttggtggctaactaccatgtaccgcaaatcgccttttca
gcgccctatctggctgaaatggtgcgtcaggagatgattaaacgttacggtgaaaatgcg
tataccgacggttatcaggtctataccacgattaccagaaagctacagttggcggcagtt
gattcattacgcgccaacgtgctggcttatgatatgcgccatggctatcgcggcccgtcc
aatgtgttatggaaggtgggcgaaagtgcctggagccgtgaacagattatcgattcactg
aaagcattgccggtgtatggcccgctgttacctgcagtagtcaccgaggcggatgccgca
caagctacggcaatgctggctgatggcagcaacgtgaccttgccgatggtcggtatacgg
tgggcgcgtccgtttaaatcggataacgcccaaggtccggtccccaaaaaagcgactgat
gtcgttcagcctggtcagcaaatttgggtcagaaaggtcgatgataactggtggctggct
caagtgccggacgtcaattctgcgctggtgtctatcgatcccaataacggtgcaattaaa
gcgctagtaggcggttttgattttaaccaaagcaaatttaaccgggcaacgcaggcactg
cgtcaggttggctcgaatattaagccattcctgtataccgccgcgatggacaaaggcctg
acgctggccactatcctcaatgacctgccaatcacccgttgggattctggcgcaggcacc
gactggcggccaaaaaactcacctcccacttacgatggccctatccgtttgcgtcagggt
ttaggccaatcgaaaaacgtggtcatggtgcgggcaatgcgggccatgggggtggattac
gcggctgagtatttgcagcgctttggtttccctgcgcagaatatcgtgcattcagaatca
ctggctctgggttctgcctcctttacaccattacagctagtccgtggctatgccgtgcta
gcaaatggcggttacctggttgatccgtacttcatcactaaaatcactgatgatgtcggt
aatgttctgtttgaaacaaagccgaaggttgtctgtgataactgtaacttgccggtcatt
tacggtgatacccaacgttcagttgtactttctgacgacaatattgagaacgttgcaacc
tcgcagaaccagaatgccagtaacgtgccaatgccagagctggaacaggtgacaccggca
caaacgacgctaaatagcgaacagcaatatgcgccacacgtgataagcaccccgctggcg
ttcttgatgcgtgatgcattgaattctaatattttcggggaacctggctggatgggtacg
ggctggcgtgcgggtcgtgacctgaaacgtaaggatatcggcggtaaaacgggtacgaca
aacagctcgaaggatgcctggttctccggctacggcccagataccgtgacatccgtctgg
attggctttgatgaccatcgccgtaatttgggccgcagcacggcatcaggggcgatacca
gaccaaatttccggagcagaaggcggggcgaagacggcccagccagcatggaatgacttt
atgaaggtggcgcttgagggcttgccagagaagcaggttccaccaccaccgggtatcgtc
agtgtcgtgattgataagcaaacaggcaagttatctaatggcgggccgggcagccgctca
gagtactttatcgacgggacacaacccactgagcatacggtacatgaagttggtaccaca
ttgatggataacggccagactcacgaactgttctga

DBGET integrated database retrieval system