KEGG   Yersinia pestis Harbin 35 (biovar Medievalis): YPC_1498Help
Entry
YPC_1498          CDS       T01874                                 

Definition
(GenBank) putative fatty oxidation complex alpha subunit, enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
yph  Yersinia pestis Harbin 35 (biovar Medievalis)
Pathway
yph00071  Fatty acid degradation
yph00280  Valine, leucine and isoleucine degradation
yph00281  Geraniol degradation
yph00310  Lysine degradation
yph00362  Benzoate degradation
yph00380  Tryptophan metabolism
yph00410  beta-Alanine metabolism
yph00640  Propanoate metabolism
yph00650  Butanoate metabolism
yph00903  Limonene and pinene degradation
yph00930  Caprolactam degradation
yph01100  Metabolic pathways
yph01110  Biosynthesis of secondary metabolites
yph01120  Microbial metabolism in diverse environments
yph01130  Biosynthesis of antibiotics
yph01200  Carbon metabolism
yph01212  Fatty acid metabolism
Module
yph_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:yph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    YPC_1498
   00650 Butanoate metabolism
    YPC_1498
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YPC_1498
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YPC_1498
   00310 Lysine degradation
    YPC_1498
   00380 Tryptophan metabolism
    YPC_1498
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YPC_1498
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YPC_1498
   00281 Geraniol degradation
    YPC_1498
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YPC_1498
   00930 Caprolactam degradation
    YPC_1498
Enzymes [BR:yph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YPC_1498
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YPC_1498
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YPC_1498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ADV98116
LinkDB All DBs
Position
1467682..1470006
Genome map
AA seq 774 aa AA seqDB search
MSKENIVTRENTAVSENAVSEPTVNNDVGASATNSVTHPAFTLNVRPDNIGIITIDVVGD
KVNTLKAEFADQIATILQQAHALPKLQGLVIVSGKPDSFIAGADITMIAACRTAHDARVL
AQKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRICSLDDKTVLGLPEVQLGLL
PGSGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRAKAGW
LNRRALPWQERLLSGPLGKALLFRIVRKKTLAKTRGHYPAAERIIDVVRKGLDQGGPSGY
EAEARAFGELAMSPQSVALRSLFFATTSLKKETGSAATARAIHRVGVLGGGLMGGGIANV
TATRAGLPVRIKDINPQGINQALKYTWDALGKRVRSKRMRPTEQQRQMMLISGSTDYRGF
ERVDIVVEAVFEDLSLKQQMVADIERFGAAHTIFASNTSSLPISQIAALAQRPEQVIGLH
YFSPVDKMPLVEVIPHEKTSEETIATTVALARKQGKTAIVVADRAGFYVNRILAPYINEA
ARCLLDGEPIESVDNALVDFGFPVGPMMLLDEVGIDVATKIMPILVEQLGPRFAAPPSFD
VILKDGRKGRKNGRGFYLYSNPTKNSSPTKNGNSPAKRNSFKWRKNKVKPVDASIYTLLG
VTPKAHLGAGVITQRCTMLMLNEAVRCLDESIIRNPRDGDIGAVFGIGFPPFLGGPFRYL
DSLGADKVVQALRLLVQQYGERFEPCQRLVTMAEQQQQFYPVDANIDEVTDVAS
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggaaaatatcgttacccgtgaaaatacagctgtcagtgaaaatgcagtcagt
gaacctacagtgaataatgatgtgggcgcatcggccacgaattcagttacccatcccgca
tttaccctcaacgtaaggccggacaatattggcattatcaccattgatgttgttggtgac
aaagtgaataccctaaaggctgaatttgctgatcaaattgccactatattgcaacaagcg
cacgctctaccaaaattacagggactcgtcattgtttctggcaaaccagactccttcatt
gccggtgcggatatcacgatgatcgcggcttgtcgtaccgctcacgacgcccgcgtatta
gcacaaaaaggccaatcaattttggcgcaaattgccgctttccctgtgccggttgtggct
gcgattcatggcgcttgtctggggggagggctagagctggcgctggcttgccatagccgc
atatgttctctggatgataaaaccgttctcgggctaccggaggtgcaactggggttactg
cctggctccggcgggacgcaacgtctgccgcgtttagtgggggtcagtaaagcactggat
atgatattgaccggtaaacagatacggccccgtcaggcactaaaaatggggctggtggat
gatgttgtgccacgcgatatcttattggatgtggcgattcagcgcgcgaaagcggggtgg
cttaatcgacgagcattaccatggcaggagcgtttactcagtgggccgttgggtaaagct
ttattattccgtattgtccgtaaaaaaacgctagctaaaacgcgggggcactacccggcg
gctgaacgtattattgatgtggtgcgtaaaggattagatcagggcgggccaagtggttat
gaggcagaagccagagcatttggcgagttggcgatgtcgcctcagtcagtcgcattacgc
agcctgttttttgccacgacgtcactgaaaaaagagaccggaagtgcagccacagcgcgt
gcaattcatcgggtcggcgtattgggcggtggcttgatgggcggaggtattgccaacgta
acggctacccgagcgggcttgccagtgcgtatcaaagatatcaatccgcaaggaattaat
caggcgctgaaatatacctgggacgcattgggtaaacgggttcgtagtaagcggatgcgc
ccaactgaacagcagcggcagatgatgttgatctctggtagtacggattaccgtggtttt
gaacgtgtcgatattgtggtggaagcggtatttgaggatttatcactgaagcagcaaatg
gttgctgacatcgaacgatttggtgccgcccatactatttttgcctccaatacatcatca
ctccccatcagccagattgctgctttggcgcaacggccagagcaggttattggcctgcac
tattttagtccagtagataaaatgccactggttgaagtcatcccccatgaaaaaaccagt
gaagagaccatcgctaccaccgttgctttagcccggaaacagggtaaaacagccattgtg
gtggctgatcgcgctgggttctatgtaaaccgcattttggcaccttatattaatgaagct
gcccgttgcctgctcgacggagagcctatcgaatcagttgataacgcgttggtcgatttt
ggtttccccgtaggccccatgatgctgcttgatgaggttgggattgatgttgcgaccaaa
ataatgccgattctggtcgagcaattagggccgcgttttgctgcgcccccgtcatttgac
gttattttgaaggatggacgtaaagggcgcaaaaatggccgtggcttttatttatattca
aaccccacaaaaaattcatctccaacaaaaaatgggaattctccggcgaagcgtaatagc
tttaagtggagaaaaaacaaagtaaaaccagtcgatgccagtatctataccttgttgggg
gtgacacctaaagcccatcttggtgcaggcgtgattactcaacgttgtaccatgctgatg
ttgaacgaagcggtacgctgtctggatgaatcgatcattcgtaacccgcgcgatggtgat
attggtgcagtgtttgggatcggttttccgcctttcctcggtggtccgttccgctatttg
gatagcctgggagccgataaggtggtacaagcactcagattattggtacagcaatacggt
gagcgtttcgaaccttgccagcggttggtaacaatggctgaacaacaacaacaattctat
cccgtggacgccaatatagatgaggtgacggacgtggcaagctga

DBGET integrated database retrieval system