KEGG   Yersinia pestis Harbin 35 (biovar Medievalis): YPC_2703Help
Entry
YPC_2703          CDS       T01874                                 

Definition
(GenBank) putative (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydrase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
yph  Yersinia pestis Harbin 35 (biovar Medievalis)
Pathway
yph00061  Fatty acid biosynthesis
yph00780  Biotin metabolism
yph01100  Metabolic pathways
yph01212  Fatty acid metabolism
Module
yph_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:yph00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YPC_2703
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YPC_2703
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:yph01004]
    YPC_2703
Enzymes [BR:yph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     YPC_2703
Lipid biosynthesis proteins [BR:yph01004]
 Fatty acid synthase
  Component type
   YPC_2703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA NKWYS
Motif
Other DBs
NCBI-ProteinID: ADV99248
LinkDB All DBs
Position
complement(2619905..2620429)
Genome map
AA seq 174 aa AA seqDB search
MKNTELNFLKTNFLFNQDITNELNTSFGQDIIKKMIPHREPFLMVDNVELINIECRLIKA
IRRVDEKDPVFGGHFPNDPIYPGVLQQESMFQTALILMYFLLNETAIPPAEENIIHAVGT
RVYDVFHLSAVRPGELMTIRCCITEYDTFLATAIVQITVNDQIVTVGKGEFHVF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatactgaattaaattttttaaaaacgaattttttatttaaccaagatattact
aatgaattgaatacatcatttggacaagatatcattaaaaaaatgataccgcatcgtgaa
ccatttttaatggtcgacaacgtagagctgatcaatattgaatgcaggttaataaaagca
ataagaagagttgacgaaaaagacccggtatttggtggtcatttccccaatgaccctata
tatccaggtgtattgcaacaagaaagtatgtttcaaaccgcgcttattttaatgtatttt
ctgctaaatgaaacggctattccgccagcagaggagaatatcatccacgcagtgggaaca
cgagtatacgatgtctttcacttgtccgcagtacgcccaggagaattaatgacaatccgt
tgttgtattacagaatacgacacatttcttgccaccgccattgttcaaatcacggttaac
gatcagatcgtaaccgtcggaaaaggagagtttcatgtcttctga

DBGET integrated database retrieval system