KEGG   Yersinia pestis Harbin 35 (biovar Medievalis): YPC_2979Help
Entry
YPC_2979          CDS       T01874                                 

Gene name
ampH
Definition
(GenBank) putative penicillin-binding protein
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
yph  Yersinia pestis Harbin 35 (biovar Medievalis)
Brite
KEGG Orthology (KO) [BR:yph00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:yph01002]
    YPC_2979 (ampH)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:yph01011]
    YPC_2979 (ampH)
Enzymes [BR:yph01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     YPC_2979 (ampH)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     YPC_2979 (ampH)
Peptidases [BR:yph01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   YPC_2979 (ampH)
Peptidoglycan biosynthesis and degradation proteins [BR:yph01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   YPC_2979 (ampH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: ADV99504
LinkDB All DBs
Structure
PDB: 

Position
2882200..2883366
Genome map
AA seq 388 aa AA seqDB search
MDKRLLKRLSAPLLAAALWTIPLHSHADTQPLTSQDTKLLTSQIVDQYAEHIFYNSGAVG
MALVVIDNNQVVNRSFGETQPGNNIRPRPDSLIRIASITKLMTSEIMVKLADDGIVKLTD
PLKKYAPKGVNVPSYSAKQPIRLLHLASHTSGLPREQPGGPQKRPVFTWPTKDNRWQWLK
LAKVTVPPGVKAAYSNLAYDLLADALSRAAGKPYAHLLRDKITAPLGMKNTTLTPTAEQC
KRLMIGVGSSRCGNTVAAAGSGGIYSTPEDMQHWMQQFLASDNSAPKRSAKREQALYFQR
GDLVSLKGMDVAGQADALGLGWVYMAPKADLPGIMQKTGGGGGFITYMAMVPEKNIGVFV
VVTRSQLTKFSNMSDGVNQLVAELVKNH
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggataaaagattgttgaaacgtctctctgccccgctgctggctgctgctttgtggact
attccgttgcacagccatgccgatactcagccgttgacctcgcaagatactaagctgttg
acctcgcaaattgttgaccaatacgccgaacatatcttctataacagtggagctgtagga
atggctctggtggttatcgataacaatcaggtcgtcaaccgtagctttggtgaaacgcaa
cccggcaacaatattcgcccacggccagactcactgatccgcattgcatcaataaccaag
ctaatgaccagcgaaatcatggtaaaactggctgatgatggcatcgttaagttaactgac
ccgttaaaaaaatatgcaccgaaaggggtcaacgttccctcttacagtgctaagcaacct
attaggctgttgcatctggccagccataccagcggcctcccccgtgagcaacccggcggc
ccgcaaaaaagaccggtgtttacctggccgaccaaagataatcgctggcaatggttgaaa
ctggccaaagtgaccgttccaccaggcgtgaaagccgcttactctaatttagcttacgac
ttactggctgacgcactgtcacgagctgcggggaaaccgtatgcccacttattacgtgat
aaaatcaccgcaccactggggatgaaaaataccaccctgaccccgacggcggagcaatgt
aaacgcctgatgataggtgttggcagcagtcgttgtgggaatacagttgcagcagcaggt
agtggcggcatttactcgacccccgaagatatgcagcactggatgcaacaattcttagct
tctgataacagcgcccccaagcgttccgccaaacgtgagcaagcgctttacttccagcgc
ggtgacttggtgtcattgaaaggtatggatgtcgccggtcaagctgatgctctgggctta
ggctgggtttatatggcacctaaagctgacttaccgggcattatgcaaaaaaccggcggt
ggcggtggatttattacttatatggcgatggtcccagaaaaaaacattggcgtttttgtg
gtggtcacacgaagccaactgactaaattcagcaatatgagtgatggtgtgaatcaattg
gttgctgagttggtgaaaaatcattga

DBGET integrated database retrieval system