KEGG   Yersinia pestis Harbin 35 (biovar Medievalis): YPC_3699Help
Entry
YPC_3699          CDS       T01874                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase, Cu, Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
yph  Yersinia pestis Harbin 35 (biovar Medievalis)
Brite
Enzymes [BR:yph01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YPC_3699 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ADW00145
LinkDB All DBs
Position
complement(3554065..3554670)
Genome map
AA seq 201 aa AA seqDB search
MKLSTLLLPVILYSSATLAANMAGMNDKASMNDKASMNDMASMNGKASMTVKINESLPQG
NGKALGTVTVTETAYGLLFTPHLTGLAPGIHGFHLHEKPSCAPGMKDGKAVPALAAGGHL
DPNKTGVHLGPYNDKGHLGDLPGLVVNADGTATYPVLAPRLKSLSEVKQHALMIHAGGDN
YSDHPMPLGGGGARMACGVIE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagtacattattgctacctgttattctttactccagcgcaacactggccgct
aacatggctggcatgaatgataaggccagcatgaatgataaggccagcatgaatgatatg
gccagcatgaatggtaaggctagcatgactgtgaaaatcaacgaatcattgccacaaggt
aatgggaaagcgcttggcaccgtgacggtgactgaaaccgcttatggcttactgtttacg
ccacatctcactgggctggctccgggaattcacggtttccatctgcatgaaaaacccagt
tgtgctccggggatgaaagatggcaaggcagtgccagcattggcagccggggggcatctt
gacccaaataagaccggggtacaccttggtccttacaacgataaagggcatctgggggat
ctgccgggattggtggttaatgcagatggcaccgccacctatcccgtattggctccgcgc
ctgaaatcgttgtcagaggtgaaacagcatgcgttaatgatccatgctggcggtgataat
tactctgatcatccaatgcctttaggcggtggtggcgcacggatggcatgtggagtcatt
gagtaa

DBGET integrated database retrieval system