KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_3315Help
Entry
YpsIP31758_3315   CDS       T00570                                 

Gene name
sodC
Definition
(GenBank) copper/zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Brite
Enzymes [BR:ypi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YpsIP31758_3315 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABS47497
UniProt: A0A0U1QXU8
LinkDB All DBs
Structure
PDB: 

Position
complement(3723891..3724478)
Genome map
AA seq 195 aa AA seqDB search
MKLSTLLLPVILYSSATLAANMAGMNDKAGMNDKASMNDMASMTVEINESLPQGNGKALG
TVTVTETAYGLLFTPHLTGLAPGIHGFHLHEKPSCAPGMKDGKAVPALAAGGHLDPNKTG
VHLGPYNDKGHLGDLPGLVVNADGTATYPVLAPRLKSLSEVKQHALMIHAGGDNYSDHPM
PLGGGGARMACGVIE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagtacattattgctacctgttattctttactccagcgcaacactggccgct
aacatggctggcatgaatgataaggctggcatgaatgataaggccagtatgaatgatatg
gctagcatgactgtggaaatcaacgaatcattgccacaaggtaatgggaaagcgcttggc
accgtgacggtgactgaaaccgcttatggcttactgtttacgccacatctcactgggctg
gctccgggaattcacggtttccatctgcatgaaaaacccagttgtgctccggggatgaaa
gatggcaaggcagtgccagcattggcagccggggggcatcttgacccaaataagaccggg
gtacaccttggtccttacaacgataaagggcatctgggggatctgccgggattggtggtt
aatgcagatggcaccgccacctatcccgtattggctccgcgcctgaaatcgttgtcagag
gtgaaacagcatgcgttaatgatccatgctggcggtgataattactctgatcatccaatg
cctttaggcggtggtggcgcacggatggcatgtggagtcattgagtaa

DBGET integrated database retrieval system