KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_4121Help
Entry
YpsIP31758_4121   CDS       T00570                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase (Mn)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Brite
Enzymes [BR:ypi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YpsIP31758_4121 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABS45925
UniProt: A0A0U1QU45
LinkDB All DBs
Position
4652098..4652721
Genome map
AA seq 207 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELADLSVEDLIKD
LDKVPAEKRTFMRNNAGGHANHSLFWKGLKLGTTLAGDLKAAIERDFGSVDSFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGVSGFPIVGLDVWEHAYYLKFQ
NRRPDYIKAFWNVVNWDEAAARFAQAK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatcactgccttatgcttatgatgccttagaaccacacttcgat
aagcagacgatggaaatccatcacaccaaacaccatcagacctatgttaacaatgcaaat
acggtgttggagagcttcccggagctggcggacctgagcgttgaagatctgatcaaagat
ctggataaagtccctgctgaaaagcgcacctttatgcgtaacaacgcaggcggccacgct
aaccacagtctgttctggaaaggcctgaaactgggcaccaccctagccggtgacctgaaa
gccgctatcgagcgcgatttcggcagcgtagacagcttcaaagaaaaatttgaacaagct
gctgcgacccgtttcggttctggctgggcttggctggtactgaaagacgacggcaaactg
gcggttgtttcaaccgctaaccaagacagcccgctgatgggcgaagccgtttctggcgta
tcaggtttcccgattgtgggcctggacgtatgggaacacgcttactacctgaaattccaa
aaccgccgcccagactacatcaaagccttctggaacgtggttaactgggatgaagctgca
gcgcgtttcgctcaagccaagtaa

DBGET integrated database retrieval system