KEGG   Yersinia pestis Harbin35: CH55_1322Help
Entry
CH55_1322         CDS       T03717                                 

Definition
(GenBank) putative enzyme
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
ypj  Yersinia pestis Harbin35
Brite
KEGG Orthology (KO) [BR:ypj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ypj01002]
    CH55_1322
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ypj01011]
    CH55_1322
Enzymes [BR:ypj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CH55_1322
   3.4.21  Serine endopeptidases
    3.4.21.-  
     CH55_1322
Peptidases and inhibitors [BR:ypj01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   CH55_1322
Peptidoglycan biosynthesis and degradation proteins [BR:ypj01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CH55_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AJK06444
UniProt: A0A2S9PKZ7
LinkDB All DBs
Structure
PDB: 

Position
1420985..1422151
Genome map
AA seq 388 aa AA seqDB search
MDKRLLKRLSAPLLAAALWTIPLHSHADTQPLTSQDTKLLTSQIVDQYAEHIFYNSGAVG
MALVVIDNNQVVNRSFGETQPGNNIRPRPDSLIRIASITKLMTSEIMVKLADDGIVKLTD
PLKKYAPKGVNVPSYSAKQPIRLLHLASHTSGLPREQPGGPQKRPVFTWPTKDNRWQWLK
LAKVTVPPGVKAAYSNLAYDLLADALSRAAGKPYAHLLRDKITAPLGMKNTTLTPTAEQC
KRLMIGVGSSRCGNTVAAAGSGGIYSTPEDMQHWMQQFLASDNSAPKRSAKREQALYFQR
GDLVSLKGMDVAGQADALGLGWVYMAPKADLPGIMQKTGGGGGFITYMAMVPEKNIGVFV
VVTRSQLTKFSNMSDGVNQLVAELVKNH
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggataaaagattgttgaaacgtctctctgccccgctgctggctgctgctttgtggact
attccgttgcacagccatgccgatactcagccgttgacctcgcaagatactaagctgttg
acctcgcaaattgttgaccaatacgccgaacatatcttctataacagtggagctgtagga
atggctctggtggttatcgataacaatcaggtcgtcaaccgtagctttggtgaaacgcaa
cccggcaacaatattcgcccacggccagactcactgatccgcattgcatcaataaccaag
ctaatgaccagcgaaatcatggtaaaactggctgatgatggcatcgttaagttaactgac
ccgttaaaaaaatatgcaccgaaaggggtcaacgttccctcttacagtgctaagcaacct
attaggctgttgcatctggccagccataccagcggcctcccccgtgagcaacccggcggc
ccgcaaaaaagaccggtgtttacctggccgaccaaagataatcgctggcaatggttgaaa
ctggccaaagtgaccgttccaccaggcgtgaaagccgcttactctaatttagcttacgac
ttactggctgacgcactgtcacgagctgcggggaaaccgtatgcccacttattacgtgat
aaaatcaccgcaccactggggatgaaaaataccaccctgaccccgacggcggagcaatgt
aaacgcctgatgataggtgttggcagcagtcgttgtgggaatacagttgcagcagcaggt
agtggcggcatttactcgacccccgaagatatgcagcactggatgcaacaattcttagct
tctgataacagcgcccccaagcgttccgccaaacgtgagcaagcgctttacttccagcgc
ggtgacttggtgtcattgaaaggtatggatgtcgccggtcaagctgatgctctgggctta
ggctgggtttatatggcacctaaagctgacttaccgggcattatgcaaaaaaccggcggt
ggcggtggatttattacttatatggcgatggtcccagaaaaaaacattggcgtttttgtg
gtggtcacacgaagccaactgactaaattcagcaatatgagtgatggtgtgaatcaattg
gttgctgagttggtgaaaaatcattga

DBGET integrated database retrieval system