KEGG   Yersinia pestis Harbin35: CH55_1574Help
Entry
CH55_1574         CDS       T03717                                 

Gene name
dacA
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase dacA
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ypj  Yersinia pestis Harbin35
Pathway
ypj00550  Peptidoglycan biosynthesis
ypj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CH55_1574 (dacA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ypj01002]
    CH55_1574 (dacA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ypj01011]
    CH55_1574 (dacA)
Enzymes [BR:ypj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CH55_1574 (dacA)
Peptidases [BR:ypj01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   CH55_1574 (dacA)
Peptidoglycan biosynthesis and degradation proteins [BR:ypj01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CH55_1574 (dacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AJK06549
LinkDB All DBs
Position
1689143..1690027
Genome map
AA seq 294 aa AA seqDB search
MKYVITSRIIKSLALGTVIVMSAANADDVNLKTMIPGVPQIDAEAYILIDYNSGKVLAEM
NADTRRNPASLTKMMTSYVIGQAIKSGKIGAEDMVTVGKDAWATGNPEFKGSSLMFLKPG
DRVPVSKLTRGINLQSGNDACVAMADYVAGSQDSFVNLMNNYVKALGLQNTHFKTVHGLD
AEGQFSSARDMALIGQALIRDVPDEYAIYKEKEFTFNNIRQTNRNGLLWDTSLNVDGIKT
GHTEAAGYNLVASATDGQMRLISVVLGGHTFKGRETESKKLLTWGSVSLKPSHR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgtaattacctctcgcattatcaagagcctagcgctcggcactgttattgtc
atgagcgctgctaacgctgatgacgtcaatctgaaaaccatgatccccggcgtaccgcag
atcgacgcagaagcctacatcctaattgattacaactccgggaaagtattggcggaaatg
aacgcggatacgcgccgcaacccagccagtttgaccaaaatgatgaccagctacgtcatc
ggccaggcgattaaatcagggaaaatcggggctgaagacatggtcaccgtgggtaaagat
gcctgggctaccggtaacccggaatttaaaggctcctccctgatgtttctgaaaccgggc
gaccgtgtgccggtgtctaaactgacccgtggtatcaacttacaatcgggtaacgatgcc
tgcgtcgcgatggccgattatgtcgcggggagtcaggactcattcgttaacctgatgaac
aactatgttaaggcgctgggcttacaaaatacccacttcaaaactgttcacggtttagat
gcggaaggccagttcagctctgcacgcgatatggcattgattggtcaagccctgatccgt
gatgtgccagatgagtatgctatctataaagagaaagagtttaccttcaacaatatccgc
cagacaaaccgtaacggtttactgtgggacaccagtttgaacgtagatggcatcaaaacc
ggtcacaccgaggcagcaggttataatctggtcgcatcagcgactgatggacagatgcgt
ttgatttcagtcgttttaggcggccatacctttaagggccgtgaaactgaaagtaaaaaa
ctgctgacctggggttccgtttctttgaaaccgtcgcaccgctga

DBGET integrated database retrieval system