KEGG   Yersinia pestis Harbin35: CH55_2742Help
Entry
CH55_2742         CDS       T03717                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ypj  Yersinia pestis Harbin35
Brite
Enzymes [BR:ypj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CH55_2742 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AJK06654
UniProt: A0A384LEC1 A0A380PI18
LinkDB All DBs
Position
2997199..2997822
Genome map
AA seq 207 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELADLSVEDLIKD
LDKVPAEKRTFMRNNAGGHANHSLFWKGLKLGTTLAGDLKAAIERDFGSVDSFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGVSGFPIVGLDVWEHAYYLKFQ
NRRPDYIKAFWNVVNWDEAAARFAQAK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatcactgccttatgcttatgatgccttagaaccacacttcgat
aagcagacgatggaaatccatcacaccaaacaccatcagacctatgttaacaatgcaaat
acggtgttggagagcttcccggagctggcggacctgagcgttgaagatctgatcaaagat
ctggataaagtccctgctgaaaagcgcacctttatgcgtaacaacgcaggcggccacgct
aaccacagtctgttctggaaaggcctgaaactgggcaccaccctagccggtgacctgaaa
gccgctatcgagcgcgatttcggcagcgtagacagcttcaaagaaaaatttgaacaagct
gctgcgacccgtttcggttctggctgggcttggctggtactgaaagacgacggcaaactg
gcggttgtttcaaccgctaaccaagacagcccgctgatgggcgaagccgtttctggcgta
tcaggtttcccgattgtgggcctggacgtatgggaacacgcttactacctgaaattccaa
aaccgccgcccagactacatcaaagccttctggaacgtggttaactgggatgaagctgca
gcgcgtttcgctcaagccaagtaa

DBGET integrated database retrieval system