KEGG   Yersinia pestis Harbin35: CH55_2888Help
Entry
CH55_2888         CDS       T03717                                 

Definition
(GenBank) penicillin-binding, 1A family protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
ypj  Yersinia pestis Harbin35
Pathway
ypj00550  Peptidoglycan biosynthesis
ypj01100  Metabolic pathways
ypj01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ypj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CH55_2888
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CH55_2888
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ypj01003]
    CH55_2888
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ypj01011]
    CH55_2888
Enzymes [BR:ypj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CH55_2888
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CH55_2888
Glycosyltransferases [BR:ypj01003]
 Polysaccharide
  Bacterial polysaccharide
   CH55_2888
Peptidoglycan biosynthesis and degradation proteins [BR:ypj01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CH55_2888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase DUF3502
Motif
Other DBs
NCBI-ProteinID: AJK07284
UniProt: A0A3N4BAV8
LinkDB All DBs
Position
complement(3158829..3161384)
Genome map
AA seq 851 aa AA seqDB search
MKFVKYFLILAVCCILLGAASIFGLYKYIEPQLPDVATLKDIRLQTPMQVYSAEGELIAQ
FGEKRRIPLTLNQIPPEMVHAFIATEDSRFYDHHGVDPVGILRAVSIAMLSGRASQGAST
ITQQLARNFFLSPERTLMRKIKEAFLAIRIEQMLTKDEILELYLNKIYLGYRAYGVGAAA
QVYFGKEVHELTLSQIAMIAGLPKAPSTFNPLYSHDRAVARRNVVLLRMLDEKYITQAQY
DQARSEELVANYHVPQIAFSAPYLAEMVRQEMIKRYGENAYTDGYQVYTTITRKLQLAAV
DSLRANVLAYDMRHGYRGPSNVLWKVGESAWSREQIIDSLKALPVYGPLLPAVVTEADAA
QATAMLADGSNVTLPMVGIRWARPFKSDNAQGPVPKKATDVVQPGQQIWVRKVDDNWWLA
QVPDVNSALVSIDPNNGAIKALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGL
TLATILNDLPITRWDSGAGTDWRPKNSPPTYDGPIRLRQGLGQSKNVVMVRAMRAMGVDY
AAEYLQRFGFPAQNIVHSESLALGSASFTPLQLVRGYAVLANGGYLVDPYFITKITDDVG
NVLFETKPKVVCDNCNLPVIYGDTQRSVVLSDDNIENVATSQNQNASNVPMPELEQVTPA
QTTLNSEQQYAPHVISTPLAFLMRDALNSNIFGEPGWMGTGWRAGRDLKRKDIGGKTGTT
NSSKDAWFSGYGPDTVTSVWIGFDDHRRNLGRSTASGAIPDQISGAEGGAKTAQPAWNDF
MKVALEGLPEKQVPPPPGIVSVVIDKQTGKLSNGGPGSRSEYFIDGTQPTEHTVHEVGTT
LMDNGQTHELF
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcgtaaagtattttttaatccttgcggtgtgttgcattttactgggagcagcc
tcgatatttggcctgtacaaatatattgagccgcagctacccgatgttgccacgctgaaa
gacatccggctgcaaacacctatgcaggtgtatagcgccgaaggcgaattgatcgctcaa
ttcggcgaaaaacgtcgtatcccattgacgttgaatcaaataccaccagaaatggtgcat
gcgtttatcgccacagaagacagccgtttttacgatcatcacggtgtcgaccctgtgggg
atcctgcgtgcagtctctatcgccatgttgtctggtcgcgcctcccaaggggcgagtacc
attacccagcaattggcgaggaacttctttttaagccctgaacggactttgatgcgaaaa
atcaaggaagcatttctggctatccgcatcgaacagatgctgaccaaagatgaaatcctt
gagctgtatctgaacaaaatttatctcggttaccgcgcctatggtgtcggtgctgcggcc
caagtctatttcggcaaagaagtccatgaattgaccctcagccaaatagcgatgatcgcc
gggttacctaaagcgccttctacgtttaacccgctctactcacatgacagagccgtggca
cggcgtaatgtggtgctgctacgtatgctggatgaaaaatacatcactcaggcgcaatac
gatcaagcccgcagtgaagagttggtggctaactaccatgtaccgcaaatcgccttttca
gcgccctatctggctgaaatggtgcgtcaggagatgattaaacgttacggtgaaaatgcg
tataccgacggttatcaggtctataccacgattaccagaaagctacagttggcggcagtt
gattcattacgcgccaacgtgctggcttatgatatgcgccatggctatcgcggcccgtcc
aatgtgttatggaaggtgggcgaaagtgcctggagccgtgaacagattatcgattcactg
aaagcattgccggtgtatggcccgctgttacctgcagtagtcaccgaggcggatgccgca
caagctacggcaatgctggctgatggcagcaacgtgaccttgccgatggtcggtatacgg
tgggcgcgtccgtttaaatcggataacgcccaaggtccggtccccaaaaaagcgactgat
gtcgttcagcctggtcagcaaatttgggtcagaaaggtcgatgataactggtggctggct
caagtgccggacgtcaattctgcgctggtgtctatcgatcccaataacggtgcaattaaa
gcgctagtaggcggttttgattttaaccaaagcaaatttaaccgggcaacgcaggcactg
cgtcaggttggctcgaatattaagccattcctgtataccgccgcgatggacaaaggcctg
acgctggccactatcctcaatgacctgccaatcacccgttgggattctggcgcaggcacc
gactggcggccaaaaaactcacctcccacttacgatggccctatccgtttgcgtcagggt
ttaggccaatcgaaaaacgtggtcatggtgcgggcaatgcgggccatgggggtggattac
gcggctgagtatttgcagcgctttggtttccctgcgcagaatatcgtgcattcagaatca
ctggctctgggttctgcctcctttacaccattacagctagtccgtggctatgccgtgcta
gcaaatggcggttacctggttgatccgtacttcatcactaaaatcactgatgatgtcggt
aatgttctgtttgaaacaaagccgaaggttgtctgtgataactgtaacttgccggtcatt
tacggtgatacccaacgttcagttgtactttctgacgacaatattgagaacgttgcaacc
tcgcagaaccagaatgccagtaacgtgccaatgccagagctggaacaggtgacaccggca
caaacgacgctaaatagcgaacagcaatatgcgccacacgtgataagcaccccgctggcg
ttcttgatgcgtgatgcattgaattctaatattttcggggaacctggctggatgggtacg
ggctggcgtgcgggtcgtgacctgaaacgtaaggatatcggcggtaaaacgggtacgaca
aacagctcgaaggatgcctggttctccggctacggcccagataccgtgacatccgtctgg
attggctttgatgaccatcgccgtaatttgggccgcagcacggcatcaggggcgatacca
gaccaaatttccggagcagaaggcggggcgaagacggcccagccagcatggaatgacttt
atgaaggtggcgcttgagggcttgccagagaagcaggttccaccaccaccgggtatcgtc
agtgtcgtgattgataagcaaacaggcaagttatctaatggcgggccgggcagccgctca
gagtactttatcgacgggacacaacccactgagcatacggtacatgaagttggtaccaca
ttgatggataacggccagactcacgaactgttctga

DBGET integrated database retrieval system