KEGG   Yersinia pestis Harbin35: CH55_2894Help
Entry
CH55_2894         CDS       T03717                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase 1
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ypj  Yersinia pestis Harbin35
Pathway
ypj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ypj01100  Metabolic pathways
ypj01110  Biosynthesis of secondary metabolites
ypj01130  Biosynthesis of antibiotics
ypj01230  Biosynthesis of amino acids
Module
ypj_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ypj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CH55_2894 (aroK)
Enzymes [BR:ypj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     CH55_2894 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin dNK Cytidylate_kin2 AAA AAA_22 AAA_16 TsaE APS_kinase ABC_tran AAA_25 AAA_5 AAA_7 AAA_28 AAA_17 Ploopntkinase3 AAA_24 RNA_helicase AAA_PrkA His_biosynth ATPase_2 AAA_29 Mg_chelatase RsgA_GTPase AAA_14 IstB_IS21 AAA_2
Motif
Other DBs
NCBI-ProteinID: AJK08203
UniProt: A0A3N4AWX8
LinkDB All DBs
Position
3165873..3166394
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVGWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVDEPPREVLEALAKERNPLYEEIADVTIRTDDQSAKVVANQIINMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
ggtcgtcagttagctcagcaactcaatatggagtttttcgactctgatcaagaaattgag
cgacgtaccggagctgacgtgggctgggtattcgacgtggaaggcgaagaaggtttccgc
gatcgtgaagaaaaagtgattaatgaactgacggaaaagcaaggcattgttctggcaacc
ggtgggggctctgttaaatccagagaaacccgtaaccgtttgtcagcccgtggggttgtg
gtgtatttagaaaccactatcgagaagcagttagcccgtacacagcgtgacaaaaaacgt
ccgttgctacaggtcgatgaacctccacgtgaagtgttagaagcactggcaaaagaacgt
aatccgttgtacgaagaaattgcagatgtcactatccgcactgacgatcaaagcgcgaaa
gtggttgctaaccagattatcaacatgctggaaagtaactga

DBGET integrated database retrieval system