KEGG   Yersinia pestis Harbin35: CH55_3077Help
Entry
CH55_3077         CDS       T03717                                 

Gene name
argE
Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
ypj  Yersinia pestis Harbin35
Pathway
ypj00220  Arginine biosynthesis
ypj01100  Metabolic pathways
ypj01110  Biosynthesis of secondary metabolites
ypj01130  Biosynthesis of antibiotics
ypj01210  2-Oxocarboxylic acid metabolism
ypj01230  Biosynthesis of amino acids
Module
ypj_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ypj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CH55_3077 (argE)
Enzymes [BR:ypj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     CH55_3077 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AJK10212
UniProt: A0A380PFU3
LinkDB All DBs
Position
complement(3336122..3337285)
Genome map
AA seq 387 aa AA seqDB search
MKLPPFIELYRALIATPSISAADSALDQSNEALINLLAGWFADLGFRVEIQPVPDTRHKF
NLLASIGENENGEGHGGLLLAGHTDTVPYDEGRWTRDPFTLTEHDHKLYGLGTADMKGFF
AFILDAVRDIDASKLTKPLYILATADEETTMAGARYFAANTQLRPDFAIIGEPTSLQPVR
AHKGHISNAIRITGQSGHSSDPARGVNAIDLMHESITQLMALRTTLQERYHNPAFTIPYP
TMNFGHINGGDAANRICACCELHMDIRPLPGLTLSDLNELMTEALEPVSQRWPGRLSIDE
LHPPIPGYECPTDHHMVGVIEKLLGERTAVVNYCTEAPFIQQVCPTLVLGPGSINQAHQP
DEFIDMAFIEPTRELIGQLVDHFCQQK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacctccatttattgagctgtaccgggcgttaattgcaacgccttcgatcagc
gccgctgatagtgccctcgaccaaagtaatgaggcattaatcaatttgttagccggatgg
tttgcagacctgggttttcgcgtcgagatccagccggtgcctgatactcgccacaaattt
aacctgttagccagcattggcgaaaatgaaaacggggaaggtcatggcgggttattgctg
gcgggtcataccgatactgtcccttacgatgaagggcgctggacccgcgatcccttcacc
ttgaccgagcatgaccataaactctatggcttgggtaccgcagatatgaaaggctttttt
gcttttattctggatgcggtgcgcgatattgatgccagcaagttgaccaaaccgctctat
attttggcaactgccgatgaagagaccaccatggcaggtgcgcgttattttgctgcgaat
acccagctacgccctgatttcgcgattatcggcgagccaacctcactgcaacctgtccgt
gcgcacaaaggccatatctccaacgccattcgtattaccggccagtctgggcactccagt
gatccggcccggggggtgaatgccattgatttgatgcatgaatctattacgcaattgatg
gcgctgcgtaccacactgcaagagcgttatcacaatccagcgtttactattccttatccc
accatgaattttggtcatattaatggcggtgatgcggcaaaccgtatctgtgcgtgttgt
gaattacatatggatatccgtccgttaccgggcctgacattaagtgatttaaatgagtta
atgaccgaagcgctggaaccggtgagtcaacgctggccggggcgtctcagtattgatgag
ttgcaccctccgatccctggctatgagtgcccaacagaccatcatatggtcggcgtgatc
gagaaactgctcggtgagcgcactgcggtggtgaactattgcaccgaagccccttttatt
cagcaagtctgcccgacattagtgctggggccaggttcgattaatcaggcacatcagcca
gatgaatttattgatatggcctttatcgaaccaacacgtgagctgattggtcagctagtt
gaccacttttgccagcagaaataa

DBGET integrated database retrieval system