KEGG   Yersinia pestis Harbin35: CH55_3975Help
Entry
CH55_3975         CDS       T03717                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ypj  Yersinia pestis Harbin35
Pathway
ypj00250  Alanine, aspartate and glutamate metabolism
ypj00410  beta-Alanine metabolism
ypj00640  Propanoate metabolism
ypj00650  Butanoate metabolism
ypj01100  Metabolic pathways
ypj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ypj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CH55_3975 (gabT)
   00650 Butanoate metabolism
    CH55_3975 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CH55_3975 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CH55_3975 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ypj01007]
    CH55_3975 (gabT)
Enzymes [BR:ypj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CH55_3975 (gabT)
Amino acid related enzymes [BR:ypj01007]
 Aminotransferase (transaminase)
  Class III
   CH55_3975 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJK09370
UniProt: Q0WD56
LinkDB All DBs
Position
4333982..4335271
Genome map
AA seq 429 aa AA seqDB search
MSHRELEQRRKEATPRGIGVLCDFYAVRAENATLWDEQGREYIDFTAGIATLNIGHRHPK
VMAAVRQQLDQFTHTAYQVVPYASYVTLAEKINSLAPISDSNMTAAGNSKTAFFTTGVEA
IENAVKIARAATGRPGVIAFSGAFHGRTLLAMALTGRAVPYKVGFGPFPASIFHALYPNE
LYGVSVEEAISSVERLFRCDISPTQVAAILFEPIQGEGGFNIAPPEFVSALRTLCDEHGI
LLIADEVQTGFARTGKLFAMEYYPDTKVDVITMAKSLGGGMPISAVTGRADIMDAPLPGS
LGGTYAGNPLAVAASLAVLDIIAEEKLCERALILGAKLVDVLEKAQMSNAAIVGIRARGS
MVAVEFNDPVSGKPSPELTRAYQRQALEEGLLLLSCGVHSNVIRFLYPLTIPDKQFKQAM
NILTRLLAS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaccgtgaattggaacaacgcagaaaagaggcgaccccacgtgggattggtgtg
ttatgtgatttctatgcggtacgggctgaaaatgccacgctgtgggatgaacaggggcgg
gaatatatcgattttacggcgggtattgcgacactcaatatcggacaccgccacccgaaa
gtgatggccgctgtgcgccaacaactggaccagtttacccatactgcctatcaggtggtg
ccttacgccagttatgtcacattggcagagaaaattaattcgctagcccctatttctgat
tcaaatatgacggcagcgggcaacagtaaaaccgcttttttcaccactggggtcgaagcg
atagaaaatgccgtgaaaatagcgcgtgcggcgactggccgccctggtgtgattgctttc
tccggggcatttcatggccgaaccttattggcgatggcgttgaccggtagagcggtgccg
tacaaagtcggttttggtccgttccctgcctccatttttcacgccctctatcccaatgag
ttgtatggcgtgagtgtcgaagaggccatcagcagtgttgagcgcctgtttcgttgtgat
atcagtccgacacaagtggcggccattctatttgagccgattcagggcgagggcggtttt
aatatcgccccgccggaatttgtcagtgctttgcgcaccctgtgtgatgagcacggtatt
ttgctgattgccgatgaagtacaaacggggtttgcccgtacaggcaagttatttgccatg
gaatattatcccgacaccaaagttgatgtgatcaccatggcgaaaagccttgggggcggt
atgccaatttccgcggtcacgggtcgggccgacattatggatgccccgttgccggggagt
ttgggcggtacttatgccggtaacccactggcggtggctgcgtcactggcggtgctcgat
attattgctgaagagaagttatgcgagcgcgccctgattttaggcgcgaagttggttgac
gtactggaaaaagcccaaatgagcaatgcggccattgtgggcattcgtgcgcgtggatcc
atggtggcggtggaatttaacgatcccgtcagcggtaaaccgtcaccagaactgacgcgc
gcctatcaacgtcaggcactggaagaggggctgttactcctgagttgcggtgtccacagc
aacgtgatccgcttcctctacccattgaccattcccgacaagcaatttaaacaggcgatg
aatattcttacccgcctactggcgagctaa

DBGET integrated database retrieval system