KEGG   Yersinia pestis Harbin35: CH55_7Help
Entry
CH55_7            CDS       T03717                                 

Gene name
fadJ
Definition
(GenBank) fatty oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ypj  Yersinia pestis Harbin35
Pathway
ypj00071  Fatty acid degradation
ypj00280  Valine, leucine and isoleucine degradation
ypj00281  Geraniol degradation
ypj00310  Lysine degradation
ypj00362  Benzoate degradation
ypj00380  Tryptophan metabolism
ypj00410  beta-Alanine metabolism
ypj00640  Propanoate metabolism
ypj00650  Butanoate metabolism
ypj00903  Limonene and pinene degradation
ypj00930  Caprolactam degradation
ypj01100  Metabolic pathways
ypj01110  Biosynthesis of secondary metabolites
ypj01120  Microbial metabolism in diverse environments
ypj01130  Biosynthesis of antibiotics
ypj01200  Carbon metabolism
ypj01212  Fatty acid metabolism
Module
ypj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ypj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CH55_7 (fadJ)
   00650 Butanoate metabolism
    CH55_7 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CH55_7 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CH55_7 (fadJ)
   00310 Lysine degradation
    CH55_7 (fadJ)
   00380 Tryptophan metabolism
    CH55_7 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CH55_7 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CH55_7 (fadJ)
   00281 Geraniol degradation
    CH55_7 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CH55_7 (fadJ)
   00930 Caprolactam degradation
    CH55_7 (fadJ)
Enzymes [BR:ypj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CH55_7 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CH55_7 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CH55_7 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AJK06585
UniProt: A0A380PLX7
LinkDB All DBs
Position
6489..8813
Genome map
AA seq 774 aa AA seqDB search
MSKENIVTRENTAVSENAVSEPTVNNDVGASATNSVTHPAFTLNVRPDNIGIITIDVVGD
KVNTLKAEFADQIATILQQAHALPKLQGLVIVSGKPDSFIAGADITMIAACRTAHDARVL
AQKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRICSLDDKTVLGLPEVQLGLL
PGSGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRAKAGW
LNRRALPWQERLLSGPLGKALLFRIVRKKTLAKTRGHYPAAERIIDVVRKGLDQGGPSGY
EAEARAFGELAMSPQSAALRSLFFATTSLKKETGSAATARAIHRVGVLGGGLMGGGIANV
TATRAGLPVRIKDINPQGINQALKYTWDALGKRVRSKRMRPTEQQRQMMLISGSTDYRGF
ERVDIVVEAVFEDLSLKQQMVADIERFGAAHTIFASNTSSLPISQIAALAQRPEQVIGLH
YFSPVDKMPLVEVIPHEKTSEETIATTVALARKQGKTAIVVADRAGFYVNRILAPYINEA
ARCLLDGEPIESVDNALVDFGFPVGPMMLLDEVGIDVATKIMPILVEQLGPRFAAPPSFD
VILKDGRKGRKNGRGFYLYSNPTKNSSPTKNGNSPAKRNSFKWRKNKVKPVDASIYTLLG
VTPKAHLGAGVITQRCTMLMLNEAVRCLDESIIRNPRDGDIGAVFGIGFPPFLGGPFRYL
DSLGADKVVQALRLLVQQYGERFEPCQRLVTMAEQQQQFYPVDANIDEVTDVAS
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggaaaatatcgttacccgtgaaaatacagctgtcagtgaaaatgcagtcagt
gaacctacagtgaataatgatgtgggcgcatcggccacgaattcagttacccatcccgca
tttaccctcaacgtaaggccggacaatattggcattatcaccattgatgttgttggtgac
aaagtgaataccctaaaggctgaatttgctgatcaaattgccactatattgcaacaagcg
cacgctctaccaaaattacagggactcgtcattgtttctggcaaaccagactccttcatt
gccggtgcggatatcacgatgatcgcggcttgtcgtaccgctcacgacgcccgcgtatta
gcacaaaaaggccaatcaattttggcgcaaattgccgctttccctgtgccggttgtggct
gcgattcatggcgcttgtctggggggagggctagagctggcgctggcttgccatagccgc
atatgttctctggatgataaaaccgttctcgggctaccggaggtgcaactggggttactg
cctggctccggcgggacgcaacgtctgccgcgtttagtgggggtcagtaaagcactggat
atgatattgaccggtaaacagatacggccccgtcaggcactaaaaatggggctggtggat
gatgttgtgccacgcgatatcttattggatgtggcgattcagcgcgcgaaagcggggtgg
cttaatcgacgagcattaccatggcaggagcgtttactcagtgggccgttgggtaaagct
ttattattccgtattgtccgtaaaaaaacgctagctaaaacgcgggggcactacccggcg
gctgaacgtattattgatgtggtgcgtaaaggattagatcagggcgggccaagtggttat
gaggcagaagccagagcatttggcgagttggcgatgtcgcctcagtcagccgcattacgc
agcctgttttttgccacgacgtcactgaaaaaagagaccggaagtgcagccacagcgcgt
gcaattcatcgggtcggcgtattgggcggtggcttgatgggcggaggtattgccaacgta
acggctacccgagcgggcttgccagtgcgtatcaaagatatcaatccgcaaggaattaat
caggcgctgaaatatacctgggacgcattgggtaaacgggttcgtagtaagcggatgcgc
ccaactgaacagcagcggcagatgatgttgatctctggtagtacggattaccgtggtttt
gaacgtgtcgatattgtggtggaagcggtatttgaggatttatcactgaagcagcaaatg
gttgctgacatcgaacgatttggtgccgcccatactatttttgcctccaatacatcatca
ctccccatcagccagattgctgctttggcgcaacggccagagcaggttattggcctgcac
tattttagtccagtagataaaatgccactggttgaagtcatcccccatgaaaaaaccagt
gaagagaccatcgctaccaccgttgctttagcccggaaacagggtaaaacagccattgtg
gtggctgatcgcgctgggttctatgtaaaccgcattttggcaccttatattaatgaagct
gcccgttgcctgctcgacggagagcctatcgaatcagttgataacgcgttggtcgatttt
ggtttccccgtaggccccatgatgctgcttgatgaggttgggattgatgttgcgaccaaa
ataatgccgattctggtcgagcaattagggccgcgttttgctgcgcccccgtcatttgac
gttattttgaaggatggacgtaaagggcgcaaaaatggccgtggcttttatttatattca
aaccccacaaaaaattcatctccaacaaaaaatgggaattctccggcgaagcgtaatagc
tttaagtggagaaaaaacaaagtaaaaccagtcgatgccagtatctataccttgttgggg
gtgacacctaaagcccatcttggtgcaggcgtgattactcaacgttgtaccatgctgatg
ttgaacgaagcggtacgctgtctggatgaatcgatcattcgtaacccgcgcgatggtgat
attggtgcagtgtttgggatcggttttccgcctttcctcggtggtccgttccgctatttg
gatagcctgggagccgataaggtggtacaagcactcagattattggtacagcaatacggt
gagcgtttcgaaccttgccagcggttggtaacaatggctgaacaacaacaacaattctat
cccgtggacgccaatatagatgaggtgacggacgtggcaagctga

DBGET integrated database retrieval system