KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0815Help
Entry
y0815             CDS       T00092                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase precursor (Cu-Zn)
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Enzymes [BR:ypk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     y0815 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AAM84402
UniProt: Q8D1A0
LinkDB All DBs
Position
914483..915070
Genome map
AA seq 195 aa AA seqDB search
MKLSTLLLPVILYSSATLAANMAGMNDKASMNDKASMNGKASMTVKINESLPQGNGKALG
TVTVTETAYGLLFTPHLTGLAPGIHGFHLHEKPSCAPGMKDGKAVPALAAGGHLDPNKTG
VHLGPYNDKGHLGDLPGLVVNADGTATYPVLAPRLKSLSEVKQHALMIHAGGDNYSDHPM
PLGGGGARMACGVIE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagtacattattgctacctgttattctttactccagcgcaacactggccgct
aacatggctggcatgaatgataaggccagcatgaatgataaggccagcatgaatggtaag
gctagcatgactgtgaaaatcaacgaatcattgccacaaggtaatgggaaagcgcttggc
accgtgacggtgactgaaaccgcttatggcttactgtttacgccacatctcactgggctg
gctccgggaattcacggtttccatctgcatgaaaaacccagttgtgctccggggatgaaa
gatggcaaggcagtgccagcattggcagccggggggcatcttgacccaaataagaccggg
gtacaccttggtccttacaacgataaagggcatctgggggatctgccgggattggtggtt
aatgcagatggcaccgccacctatcccgtattggctccgcgcctgaaatcgttgtcagag
gtgaaacagcatgcgttaatgatccatgctggcggtgataattactctgatcatccaatg
cctttaggcggtggtggcgcacggatggcatgtggagtcattgagtaa

DBGET integrated database retrieval system