KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0922Help
Entry
y0922             CDS       T00092                                 

Gene name
emrA
Definition
(GenBank) multidrug resistance secretion protein
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypk02000]
    y0922 (emrA)
Transporters [BR:ypk02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   y0922 (emrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD HlyD_D23 HlyD_3 Biotin_lipoyl_2 Orf78 Biotin_lipoyl DUF2157 MacB_PCD Gemini_mov CCSMST1 DUF4398
Motif
Other DBs
NCBI-ProteinID: AAM84504
UniProt: Q8D177
LinkDB All DBs
Position
complement(1039064..1040248)
Genome map
AA seq 394 aa AA seqDB search
MENTMSESAGAQAPQRPQNKKQQRKRVLLLLTAIFIMIGVAYLIYWFLVLRHHQETDNAY
ISGNQVQIMSQVPGSVVSVHFENTDFVKSGDVLVTLDPTDAEQAFEQAKTALANSVRQTH
QLIINSKQYQANIALKKTELSQAQNDLKRRVVLGAAAVIGREELQHARDAVEAAQASLDM
AVQQYNANQALVLNTPLEKQPAIEQAAAKMRDAWLTLQRTKVVSPISGYVSRRSVQVGAE
ISSGTPLMAVVPADQLWIDANFKETQLANMRIGQPATIVTDFYGDDVVYQGKVVGLDMGT
GSAFSLLPAQNATGNWIKVVQRLPVRIALDEKQLKEHPLRIGLSSLVKVDTANTDGHVLA
QNVRKEPAFMTNALSLDFAPVNQIISDIIHANAD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtggagaacaccatgagtgaaagtgcgggagcccaagccccacaacgaccgcagaataaa
aaacagcaacgtaaacgtgtactgctgttgctgacggccatttttattatgatcggggtg
gcttaccttatttattggttcctggtgctacgccatcaccaagagactgataatgcctat
atttcaggcaaccaagtccagattatgtctcaagttcccggcagtgtggtcagtgttcat
ttcgaaaatacggacttcgtcaaaagtggcgatgtgctggtgacactcgaccccaccgat
gcagaacaggcatttgagcaagcgaaaactgccttggcaaatagcgtgcgccaaacccac
cagctcattattaacagtaaacagtatcaagcgaatattgcgctgaaaaaaacggaattg
agccaggcacaaaatgacctgaagcgtcgggtggtcctgggggctgccgcagtcatcggc
cgtgaagaattgcaacacgcacgtgatgctgttgaggcggcacaagcgtcgttggatatg
gcagtgcagcaatataacgccaatcaggcgttggtcctcaatacgccattggagaaacaa
ccggcgattgagcaggcggccgctaaaatgcgtgatgcctggctcaccctgcagcgcacc
aaagtagttagcccaattagcggctatgtctcgcgtcgcagtgtacaagtgggtgctgaa
atcagtagtggtacgccgttaatggcggtggttccggcagatcaactgtggatcgacgct
aacttcaaagaaactcagttggcgaacatgcgaattggccaaccggcgactatcgtgacc
gatttttacggtgatgatgtggtttatcaagggaaagtggtcggtttagatatgggaacc
ggcagtgccttctcgctactacccgcgcaaaatgccaccggtaactggatcaaagtggtc
caacgcctgccagtacgaattgcattggatgagaaacaactgaaggagcatccgttacgt
attggtctgtcatcgctggttaaagtcgacaccgccaataccgatggacacgttttggca
caaaacgtgcgtaaagaacccgcgttcatgaccaatgcattgtcattagatttcgcgcca
gttaatcaaataattagcgatattattcatgcaaacgccgattaa

DBGET integrated database retrieval system