KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y1580Help
Entry
y1580             CDS       T00092                                 

Definition
(GenBank) putative enzyme
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00071  Fatty acid degradation
ypk00280  Valine, leucine and isoleucine degradation
ypk00281  Geraniol degradation
ypk00310  Lysine degradation
ypk00362  Benzoate degradation
ypk00380  Tryptophan metabolism
ypk00410  beta-Alanine metabolism
ypk00640  Propanoate metabolism
ypk00650  Butanoate metabolism
ypk00903  Limonene and pinene degradation
ypk00930  Caprolactam degradation
ypk01100  Metabolic pathways
ypk01110  Biosynthesis of secondary metabolites
ypk01120  Microbial metabolism in diverse environments
ypk01130  Biosynthesis of antibiotics
ypk01200  Carbon metabolism
ypk01212  Fatty acid metabolism
Module
ypk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    y1580
   00650 Butanoate metabolism
    y1580
  09103 Lipid metabolism
   00071 Fatty acid degradation
    y1580
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    y1580
   00310 Lysine degradation
    y1580
   00380 Tryptophan metabolism
    y1580
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    y1580
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    y1580
   00281 Geraniol degradation
    y1580
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    y1580
   00930 Caprolactam degradation
    y1580
Enzymes [BR:ypk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     y1580
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     y1580
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     y1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AAM85149
UniProt: Q8ZD45
LinkDB All DBs
Position
1746658..1748985
Genome map
AA seq 775 aa AA seqDB search
MMSKENIVTRENTAVSENAVSEPTVNNDVGASATNSVTHPAFTLNVRPDNIGIITIDVVG
DKVNTLKAEFADQIATILQQAHALPKLQGLVIVSGKPDSFIAGADITMIAACRTAHDARV
LAQKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRICSLDDKTVLGLPEVQLGL
LPGSGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRAKAG
WLNRRALPWQERLLSGPLGKALLFRIVRKKTLAKTRGHYPAAERIIDVVRKGLDQGGPSG
YEAEARAFGELAMSPQSAALRSLFFATTSLKKETGSAATARAIHRVGVLGGGLMGGGIAN
VTATRAGLPVRIKDINPQGINQALKYTWDALGKRVRSKRMRPTEQQRQMMLISGSTDYRG
FERVDIVVEAVFEDLSLKQQMVADIERFGAAHTIFASNTSSLPISQIAALAQRPEQVIGL
HYFSPVDKMPLVEVIPHEKTSEETIATTVALARKQGKTAIVVADRAGFYVNRILAPYINE
AARCLLDGEPIESVDNALVDFGFPVGPMMLLDEVGIDVATKIMPILVEQLGPRFAAPPSF
DVILKDGRKGRKNGRGFYLYSNPTKNSSPTKNGNSPAKRNSFKWRKNKVKPVDASIYTLL
GVTPKAHLGAGVITQRCTMLMLNEAVRCLDESIIRNPRDGDIGAVFGIGFPPFLGGPFRY
LDSLGADKVVQALRLLVQQYGERFEPCQRLVTMAEQQQQFYPVDANIDEVTDVAS
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
gtgatgagcaaggaaaatatcgttacccgtgaaaatacagctgtcagtgaaaatgcagtc
agtgaacctacagtgaataatgatgtgggcgcatcggccacgaattcagttacccatccc
gcatttaccctcaacgtaaggccggacaatattggcattatcaccattgatgttgttggt
gacaaagtgaataccctaaaggctgaatttgctgatcaaattgccactatattgcaacaa
gcgcacgctctaccaaaattacagggactcgtcattgtttctggcaaaccagactccttc
attgccggtgcggatatcacgatgatcgcggcttgtcgtaccgctcacgacgcccgcgta
ttagcacaaaaaggccaatcaattttggcgcaaattgccgctttccctgtgccggttgtg
gctgcgattcatggcgcttgtctggggggagggctagagctggcgctggcttgccatagc
cgcatatgttctctggatgataaaaccgttctcgggctaccggaggtgcaactggggtta
ctgcctggctccggcgggacgcaacgtctgccgcgtttagtgggggtcagtaaagcactg
gatatgatattgaccggtaaacagatacggccccgtcaggcactaaaaatggggctggtg
gatgatgttgtgccacgcgatatcttattggatgtggcgattcagcgcgcgaaagcgggg
tggcttaatcgacgagcattaccatggcaggagcgtttactcagtgggccgttgggtaaa
gctttattattccgtattgtccgtaaaaaaacgctagctaaaacgcgggggcactacccg
gcggctgaacgtattattgatgtggtgcgtaaaggattagatcagggcgggccaagtggt
tatgaggcagaagccagagcatttggcgagttggcgatgtcgcctcagtcagccgcatta
cgcagcctgttttttgccacgacgtcactgaaaaaagagaccggaagtgcagccacagcg
cgtgcaattcatcgggtcggcgtattgggcggtggcttgatgggcggaggtattgccaac
gtaacggctacccgagcgggcttgccagtgcgtatcaaagatatcaatccgcaaggaatt
aatcaggcgctgaaatatacctgggacgcattgggtaaacgggttcgtagtaagcggatg
cgcccaactgaacagcagcggcagatgatgttgatctctggtagtacggattaccgtggt
tttgaacgtgtcgatattgtggtggaagcggtatttgaggatttatcactgaagcagcaa
atggttgctgacatcgaacgatttggtgccgcccatactatttttgcctccaatacatca
tcactccccatcagccagattgctgctttggcgcaacggccagagcaggttattggcctg
cactattttagtccagtagataaaatgccactggttgaagtcatcccccatgaaaaaacc
agtgaagagaccatcgctaccaccgttgctttagcccggaaacagggtaaaacagccatt
gtggtggctgatcgcgctgggttctatgtaaaccgcattttggcaccttatattaatgaa
gctgcccgttgcctgctcgacggagagcctatcgaatcagttgataacgcgttggtcgat
tttggtttccccgtaggccccatgatgctgcttgatgaggttgggattgatgttgcgacc
aaaataatgccgattctggtcgagcaattagggccgcgttttgctgcgcccccgtcattt
gacgttattttgaaggatggacgtaaagggcgcaaaaatggccgtggcttttatttatat
tcaaaccccacaaaaaattcatctccaacaaaaaatgggaattctccggcgaagcgtaat
agctttaagtggagaaaaaacaaagtaaaaccagtcgatgccagtatctataccttgttg
ggggtgacacctaaagcccatcttggtgcaggcgtgattactcaacgttgtaccatgctg
atgttgaacgaagcggtacgctgtctggatgaatcgatcattcgtaacccgcgcgatggt
gatattggtgcagtgtttgggatcggttttccgcctttcctcggtggtccgttccgctat
ttggatagcctgggagccgataaggtggtacaagcactcagattattggtacagcaatac
ggtgagcgtttcgaaccttgccagcggttggtaacaatggctgaacaacaacaacaattc
tatcccgtggacgccaatatagatgaggtgacggacgtggcaagctga

DBGET integrated database retrieval system