KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y1968Help
Entry
y1968             CDS       T00092                                 

Gene name
gst
Definition
(GenBank) glutathionine S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00480  Glutathione metabolism
ypk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    y1968 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypk02000]
    y1968 (gst)
Enzymes [BR:ypk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     y1968 (gst)
Transporters [BR:ypk02000]
 Other transporters
  Pores ion channels [TC:1]
   y1968 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AAM85534
UniProt: Q8D0L3
LinkDB All DBs
Structure
PDB: 

Position
complement(2168209..2168817)
Genome map
AA seq 202 aa AA seqDB search
MMKLFYKPGACSLSPHIVLREAGLDFSIERVDLVTKKTETGADYLSINPKGQVPALVLDD
GSLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFIATELHKGFSPLFNPNTPD
EYKTIVRERLDKQFSYVDSVLAEHDYLLGKKFSVADAYLFTVSRWANALNLQIKERSHLD
QYMARVAERPAVKAALAAEDIK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaactgttctataaaccgggtgcttgttctctgtccccccatattgtgttgcgg
gaagcaggactagatttcagcattgaacgtgttgatttagtgacaaaaaagactgaaacg
ggtgcagactatttaagcatcaaccccaaaggacaagtaccggctttagtgctggatgac
ggtagcctactgactgaaggggtagctattgtgcaatatttggcagataaagtcccagac
cgccacttgattgccccatcagggacgctctcgcgctatcatgccattgagtggctgaat
tttatcgcgactgaactacataaaggttttagcccactatttaacccaaatacaccggat
gagtataagacgattgtccgcgagcggctggataagcaattcagctacgttgatagcgta
ttagcagagcatgattatctactaggtaaaaaattcagtgtggcagatgcctacttattt
accgttagccgttgggctaatgcgttaaatcttcaaatcaaagaacgcagccatttggat
caatatatggcgcgggtcgctgaacgccctgcggtaaaagcagctttagccgccgaagat
atcaagtaa

DBGET integrated database retrieval system