KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2145Help
Entry
y2145             CDS       T00092                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00240  Pyrimidine metabolism
ypk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    y2145 (tdk)
Enzymes [BR:ypk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     y2145 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AAM85707
UniProt: Q8ZEJ1
LinkDB All DBs
Position
complement(2370301..2370891)
Genome map
AA seq 196 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRFGVGTVSSRIGLSSQAQ
LYNSGTSLLSIIAAEHQDTPIHCILLDECQFLTKEQVQELCQVVDELHLPVLCYGLRTDF
LGELFPGSKYLLAWADKLVELKTICHCGRKANMVLRLDEQGRAVHNGEQVVIGGNESYVS
VCRRHYKEAIKAACCS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttacttttattactctgcaatgaacgcggggaaatccacagcacttcta
cagtcctcatataactaccaagaacgaggtatgcgcaccttggtgtttacggctgagata
gataaccgctttggtgtcggaacggtaagttcacgcattggcctctcttctcaggcccag
ctctataatagcgggacatcattgttatctattatcgccgctgagcaccaggacacacct
attcattgtattctattggatgaatgtcaatttctgactaaagagcaggtccaggaactc
tgtcaggttgttgatgaattacatcttcctgttctttgctacggcctgcggactgatttt
ctcggcgaattatttcccggtagtaaatatttactggcgtgggcggacaaattagtggag
ttgaaaaccatttgtcattgcggtcgtaaagcaaacatggttcttcgcctggatgagcag
gggagagcggtacacaatggtgaacaggtcgttattggtggcaatgaaagctatgtttct
gtctgccgccgccattataaagaagcaattaaagccgcctgctgttcgtag

DBGET integrated database retrieval system