KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2914Help
Entry
y2914             CDS       T00092                                 

Definition
(GenBank) hypothetical protein
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YejG DUF3305
Motif
Other DBs
NCBI-ProteinID: AAM86465
UniProt: A0A3N4B556
LinkDB All DBs
Position
complement(3220884..3221228)
Genome map
AA seq 114 aa AA seqDB search
MNNIQLSVVHRLPQSYRWLSGFIGAKVEPTPLTTIDDTHDLMGLKLLSHDGNHARHIMQR
LHLSLQDIQVNSSIIEWEGEPCLFVHRQDESATLCRLKDVGVAIAETLTAEYPF
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
gtgaataatattcaactttcggtagtacatcgcctgccgcaaagttaccgttggttgtct
ggtttcatcggggctaaagttgagccgactccgttgacgacgatagacgatacccatgat
ctgatggggttgaaattactcagtcacgacggtaatcatgccaggcatatcatgcagcgg
ctccatctttcgctgcaagatatccaagtgaattcatccatcattgaatgggaaggtgag
ccgtgcttgtttgttcaccggcaggatgaaagcgcgacgctgtgccgcctgaaagatgtc
ggtgtggccattgccgaaacgctaacggcagaataccccttctga

DBGET integrated database retrieval system